KEGG   Drosophila virilis: Dvir_GJ14531Help
Entry
Dvir_GJ14531      CDS       T01066                                 

Definition
(RefSeq) GJ14531 gene product from transcript GJ14531-RA (EC:2.7.11.24)
  KO
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
dvi  Drosophila virilis
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Toll and Imd signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dvir_GJ14531
   04068 FoxO signaling pathway
    Dvir_GJ14531
 Organismal Systems
  Immune system
   04624 Toll and Imd signaling pathway
    Dvir_GJ14531
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dvir_GJ14531
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dvir_GJ14531
Protein kinases [BR:dvi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dvir_GJ14531
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 366 aa AA seqDB search
MSACKMQKFYKLDINRTEWEVPEIYQELQPVGSGAYGQVCKARIRGTNMDVAIKKLSRPF
QSTVHAKRAYRELMLLKHMDHENVIGLLDIFHPHPPDATLADFQHVYLVTHLMGADLNNI
IKMQNLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPCNIAVNEDCELRILDFGLARPTE
FEMTGYVATRWYRAPEIMLNWMHYSQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIM
EMLGTPPNDFMQKISSDNARHYIDSLPPMKRKDFKVVFKDANPLAIDLLEKMLELDADKR
ITAEEALAHPYMQKYAEPSDESTSPLYDQSFEDMNLTLEKWKELVYKEVLNFKPPASFAE
VLESNK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgtgcaaaatgcaaaagttttacaaattggacatcaatcgcacggaatgggaa
gtcccagaaatctatcaggaattgcagccggtgggctctggtgcatacgggcaggtgtgc
aaggcgaggatccgtggcaccaacatggatgtcgccatcaagaaactgtcgcgtcccttc
caatcaacggtgcacgcgaagcgcgcgtaccgggagctgatgctattgaagcatatggat
cacgagaatgttatcggcttgttggacatctttcatccgcatccgccggacgcgacattg
gcagactttcagcacgtctacctggtgactcacctgatgggcgcggacttgaacaacatt
atcaaaatgcagaacctgtccgacgatcatgtccagtttctggtctaccaaatactgcgt
ggtcttaagtacatacacagcgctggcgttatccatcgggatctgaagccgtgcaacatt
gcggtgaacgaggactgcgagctgcgtattctggactttggtctggcgcgtccaactgag
ttcgagatgaccggctatgtggccacgcgctggtaccgtgctccggaaatcatgctcaac
tggatgcattacagccaaaccgtcgacatttggtccgtcggctgtattatggccgagctg
atcacgcggcgcacactctttccgggcacagatcacatacaccagctgaatctgatcatg
gaaatgctgggcacaccgccgaatgatttcatgcagaagatctcctccgataacgcacgg
cattatatagattcattgccgccgatgaaacgcaaagacttcaaggttgtttttaaagat
gccaatccattggcgattgatttgctggagaagatgctggagttggacgcggataaacgc
atcacggccgaggaggcacttgctcatccatatatgcagaagtacgcggagccaagtgat
gagagcacctcgcccttgtatgatcagagttttgaggacatgaacttgacattggaaaag
tggaaggagctcgtctacaaggaggtcctcaattttaagccgcctgcgtcctttgccgaa
gtcttggaaagcaataaatga

DBGET integrated database retrieval system