KEGG   Drosophila virilis: Dvir_GJ14531Help
Entry
Dvir_GJ14531      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
dvi  Drosophila virilis
Pathway
dvi04013  MAPK signaling pathway - fly
dvi04068  FoxO signaling pathway
dvi04624  Toll and Imd signaling pathway
dvi04933  AGE-RAGE signaling pathway in diabetic complications
Module
dvi_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dvir_GJ14531
   04068 FoxO signaling pathway
    Dvir_GJ14531
 Organismal Systems
  Immune system
   04624 Toll and Imd signaling pathway
    Dvir_GJ14531
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dvir_GJ14531
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dvir_GJ14531
Protein kinases [BR:dvi01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   Dvir_GJ14531
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo RIO1 ABC1 Haspin_kinase FTA2 APH
Motif
Other DBs
NCBI-GeneID: 6635151
NCBI-ProteinID: XP_002058635
FlyBase: FBgn0201742
UniProt: B4MBY2
Position
Unknown
AA seq 366 aa AA seqDB search
MSACKMQKFYKLDINRTEWEVPEIYQELQPVGSGAYGQVCKARIRGTNMDVAIKKLSRPF
QSTVHAKRAYRELMLLKHMDHENVIGLLDIFHPHPPDATLADFQHVYLVTHLMGADLNNI
IKMQNLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPCNIAVNEDCELRILDFGLARPTE
FEMTGYVATRWYRAPEIMLNWMHYSQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIM
EMLGTPPNDFMQKISSDNARHYIDSLPPMKRKDFKVVFKDANPLAIDLLEKMLELDADKR
ITAEEALAHPYMQKYAEPSDESTSPLYDQSFEDMNLTLEKWKELVYKEVLNFKPPASFAE
VLESNK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgtgcaaaatgcaaaagttttacaaattggacatcaatcgcacggaatgggaa
gtcccagaaatctatcaggaattgcagccggtgggctctggtgcatacgggcaggtgtgc
aaggcgaggatccgtggcaccaacatggatgtcgccatcaagaaactgtcgcgtcccttc
caatcaacggtgcacgcgaagcgcgcgtaccgggagctgatgctattgaagcatatggat
cacgagaatgttatcggcttgttggacatctttcatccgcatccgccggacgcgacattg
gcagactttcagcacgtctacctggtgactcacctgatgggcgcggacttgaacaacatt
atcaaaatgcagaacctgtccgacgatcatgtccagtttctggtctaccaaatactgcgt
ggtcttaagtacatacacagcgctggcgttatccatcgggatctgaagccgtgcaacatt
gcggtgaacgaggactgcgagctgcgtattctggactttggtctggcgcgtccaactgag
ttcgagatgaccggctatgtggccacgcgctggtaccgtgctccggaaatcatgctcaac
tggatgcattacagccaaaccgtcgacatttggtccgtcggctgtattatggccgagctg
atcacgcggcgcacactctttccgggcacagatcacatacaccagctgaatctgatcatg
gaaatgctgggcacaccgccgaatgatttcatgcagaagatctcctccgataacgcacgg
cattatatagattcattgccgccgatgaaacgcaaagacttcaaggttgtttttaaagat
gccaatccattggcgattgatttgctggagaagatgctggagttggacgcggataaacgc
atcacggccgaggaggcacttgctcatccatatatgcagaagtacgcggagccaagtgat
gagagcacctcgcccttgtatgatcagagttttgaggacatgaacttgacattggaaaag
tggaaggagctcgtctacaaggaggtcctcaattttaagccgcctgcgtcctttgccgaa
gtcttggaaagcaataaatga

DBGET integrated database retrieval system