KEGG   Drosophila virilis: Dvir_GJ14556Help
Entry
Dvir_GJ14556      CDS       T01066                                 

Definition
GJ14556 gene product from transcript GJ14556-RA
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     Dvir_GJ14556
Peptidases [BR:dvi01002]
 Serine Peptidases
  Family S8: subtilisin family
   Dvir_GJ14556
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 666 aa AA seqDB search
MFIAAAAWSFAASWRLLCIGMLVLAMLLPLLIGEADAAASSLTGGLGNQAVFTSSFLVRF
RRGVDNDFAHQVADKYGFDNLGPLAGADGHEYHFKHRTLPHARSRRSLTHTRALKSHPSV
HTAVQQPGFRRVKRGLRPAIPAIHGLHYAATLGEPNSVDVEPTDPYFPMQWYLKNTGQNG
GKVRLDLNVQAAWAQGITGKNVTTAIMDDGVDYMHPDLKFNYNAEASYDFSSNDAFPYPR
YTDDWFNSHGTRCAGEVAAARDNGICGVGVAYDSKIAGIRMLDQPYMTDLIEANSMGHEP
HKIHIYSASWGPTDDGKTVDGPRNATMRAIVQGVNEGRNGLGNIYVWASGDGGEEDDCNC
DGYAASMWTISINSAINDGQNAHYDESCSSTLASTFSNGAKDPNTGVATTDLYGKCTTTH
SGTSAAAPEAAGVFALALEANPQLTWRDIQHLTVLTSKRNSLFDAKNRFYWTMNGVGLEF
NHLFGFGVLDAGAMVTLAKQWHSVPARYHCEAGEINSAQPIIMGRSLFWEIKTDACKGTD
TEVNYLEHVQAVITANASRRGDLELFLTSPMGTKSMILSRRANDDDHRDGFTKWPFMTTH
SWGEYPQGVWKLEARFNSAQTRHGHLMEWSLVLHGTKEAPYRTLSPSSPHSKLAIVKKAH
EEKKMK
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgttcattgcggcagctgcatggagctttgctgcttcatggcgactgctctgcatcggg
atgctggtgctggcgatgctgctgccgctgctgatcggcgaggccgacgccgctgccagc
agcctcaccggcggcctgggtaatcaggccgtcttcaccagctcatttctggtgcgcttc
cgtcggggcgttgacaatgacttcgcccaccaggtggccgacaagtatggtttcgacaat
ctgggaccgctggcaggcgccgatggacacgagtatcatttcaagcacaggacactaccg
catgcccgttcacgtcgcagcctgacacacacgcgtgcccttaagagtcatccctcggta
cacacggccgttcagcagccgggctttaggcgtgtcaaacgcgggttgagacctgcgatt
cctgccattcatggtctacactatgcagctacgctgggcgaaccgaatagcgttgatgtg
gagcccacagatccctactttcccatgcaatggtatctgaagaacaccggacaaaatggc
ggcaaagtgcgattggatcttaatgtgcaggccgcctgggcgcagggtattaccggcaag
aacgtgaccacggccatcatggatgacggcgtggactatatgcatccggacctgaaattc
aattataacgccgaggcgagctacgactttagcagcaatgatgcattcccctatccgcgc
tacactgacgattggtttaacagccatggaactcgctgtgctggcgaagtggctgctgcc
agagataatggaatttgcggcgtgggcgttgcctatgacagcaaaatcgcaggcatacgc
atgctggatcagccctatatgacggacctaatcgaagccaactcgatgggccacgagccg
cacaaaatacatatatacagcgcctcctggggtcctaccgatgatggcaagacggtggac
gggccgcgcaatgccaccatgcgcgccattgtccagggtgtcaatgagggacgcaatggt
ttgggcaacatctatgtgtgggcttcgggcgatggcggcgaggaggatgattgcaactgc
gatggctatgccgcctccatgtggacgatatccattaacagtgccatcaacgatggccag
aatgcgcattacgatgaaagctgcagctcgacgctggcatccacgttcagcaatggtgcc
aaggatcccaacactggcgttgccaccaccgacctctatggcaaatgtacgaccacccat
tcgggcaccagcgccgcggcacccgaggcagctggcgtctttgcgctggccttggaggca
aaccctcaactgacttggcgcgacatccagcatctgactgtgctaacatcgaagcgcaat
tccctgttcgatgccaagaaccgtttctactggacaatgaacggcgtcggattggagttc
aatcacctctttgggttcggtgtgctcgatgcgggtgccatggtgaccctggccaagcag
tggcactcggtgccagcacgctatcactgtgaagccggcgagattaacagcgctcagcca
attataatgggtcgctcgctgttctgggaaatcaaaacggatgcttgcaagggcaccgac
acggaagtgaattatttggagcacgtgcaggcggtcatcacggcaaatgcttcgcgacgc
ggcgacctcgaactcttcctcacctcgccaatgggcaccaaatccatgattctgtcacga
cgcgccaatgatgatgaccatcgcgatggtttcaccaaatggcccttcatgaccacgcac
tcctggggcgagtatccgcagggagtatggaaattggaggcacgcttcaattcagctcaa
acgcgacatggacatctaatggaatggtcgctggtgctgcacggcaccaaggaggcacct
taccgcacactgtcgccatcgtcgccccactcaaagttggccatcgttaagaaggcgcac
gaggagaagaagatgaagtaa

DBGET integrated database retrieval system