KEGG   Drosophila virilis: Dvir_GJ14710Help
Entry
Dvir_GJ14710      CDS       T01066                                 

Definition
(RefSeq) GJ14710 gene product from transcript GJ14710-RA
  KO
K10739  
replication factor A2
Organism
dvi  Drosophila virilis
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dvir_GJ14710
   03420 Nucleotide excision repair
    Dvir_GJ14710
   03430 Mismatch repair
    Dvir_GJ14710
   03440 Homologous recombination
    Dvir_GJ14710
   03460 Fanconi anemia pathway
    Dvir_GJ14710
DNA replication proteins [BR:dvi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    Dvir_GJ14710
DNA repair and recombination proteins [BR:dvi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     Dvir_GJ14710
   MMR (mismatch exicision repair)
     Dvir_GJ14710
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     Dvir_GJ14710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 242 aa AA seqDB search
MNDSFGDFNATQTATAGATKESSGEGIISLLVKQILDSPEGNFKMFDVTYALVCAVGIVR
NIETSSTKITYSLEDHSGRIDAHYWLEEGDAIKSPDVMINNYVKIYGSVRSQAGQKVLMV
FKLINVLDPNEVCTHILEALHSRYKAEEYHVKGDTSAAASNTLMTNVTATQSNAIVAGLD
SKQLAVFQAIKSNCSEEGIHRRELNAKFSHISQAEMNNILDFMISEGHIYSSIDADHFIC
TM
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaacgattcctttggagatttcaatgccacacaaacggccactgccggcgccacaaag
gaatcctccggcgagggtattatttcgctgctggtcaagcagattcttgattcacccgag
ggcaatttcaagatgttcgatgttacctatgctttggtctgcgccgtgggcattgtgcgc
aacattgaaacgtcctcaacgaagatcacatactccttggaggatcacagtggacgcatt
gatgcacactactggctggaggagggcgatgccatcaagtcgcccgatgtgatgattaat
aactatgtgaaaatctatggttcagtgcgctcgcaggcgggccaaaaagttctgatggtc
ttcaagctgataaatgtgctagatcccaacgaggtgtgcacccacattctggaggcgttg
cattcgcgttacaaggccgaggagtaccatgtcaagggcgacacatcagctgcagccagc
aacacgctaatgaccaatgtaactgccacacaaagcaatgccattgttgctggcctggac
agcaagcagctggccgtcttccaggctattaagagcaactgctccgaggagggcatccat
cgacgcgaactgaatgccaagttctctcacataagccaagccgaaatgaacaacattctg
gactttatgatatctgagggccacatttactccagcatcgatgcagatcactttatatgc
accatgtag

DBGET integrated database retrieval system