KEGG   Drosophila virilis: Dvir_GJ14710Help
Entry
Dvir_GJ14710      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K10739  
replication factor A2
Organism
dvi  Drosophila virilis
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dvir_GJ14710
   03420 Nucleotide excision repair
    Dvir_GJ14710
   03430 Mismatch repair
    Dvir_GJ14710
   03440 Homologous recombination
    Dvir_GJ14710
   03460 Fanconi anemia pathway
    Dvir_GJ14710
DNA replication proteins [BR:dvi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    Dvir_GJ14710
DNA repair and recombination proteins [BR:dvi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     Dvir_GJ14710
   MMR (mismatch exicision repair)
     Dvir_GJ14710
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     Dvir_GJ14710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 242 aa AA seqDB search
MNDSFGDFNATQTATAGATKESSGEGIISLLVKQILDSPEGNFKMFDVTYALVCAVGIVR
NIETSSTKITYSLEDHSGRIDAHYWLEEGDAIKSPDVMINNYVKIYGSVRSQAGQKVLMV
FKLINVLDPNEVCTHILEALHSRYKAEEYHVKGDTSAAASNTLMTNVTATQSNAIVAGLD
SKQLAVFQAIKSNCSEEGIHRRELNAKFSHISQAEMNNILDFMISEGHIYSSIDADHFIC
TM
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaacgattcctttggagatttcaatgccacacaaacggccactgccggcgccacaaag
gaatcctccggcgagggtattatttcgctgctggtcaagcagattcttgattcacccgag
ggcaatttcaagatgttcgatgttacctatgctttggtctgcgccgtgggcattgtgcgc
aacattgaaacgtcctcaacgaagatcacatactccttggaggatcacagtggacgcatt
gatgcacactactggctggaggagggcgatgccatcaagtcgcccgatgtgatgattaat
aactatgtgaaaatctatggttcagtgcgctcgcaggcgggccaaaaagttctgatggtc
ttcaagctgataaatgtgctagatcccaacgaggtgtgcacccacattctggaggcgttg
cattcgcgttacaaggccgaggagtaccatgtcaagggcgacacatcagctgcagccagc
aacacgctaatgaccaatgtaactgccacacaaagcaatgccattgttgctggcctggac
agcaagcagctggccgtcttccaggctattaagagcaactgctccgaggagggcatccat
cgacgcgaactgaatgccaagttctctcacataagccaagccgaaatgaacaacattctg
gactttatgatatctgagggccacatttactccagcatcgatgcagatcactttatatgc
accatgtag

DBGET integrated database retrieval system