KEGG   Drosophila virilis: Dvir_GJ14779Help
Entry
Dvir_GJ14779      CDS       T01066                                 

Definition
GJ14779 gene product from transcript GJ14779-RA
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
dvi  Drosophila virilis
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dvir_GJ14779
Protein phosphatases and associated proteins [BR:dvi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Dvir_GJ14779
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 170 aa AA seqDB search
MGNETSLPMDMCSNFDADEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVID
IFDADGNGEVDFKEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTICFADKDEDGKISFDEFCSVVGNTDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacgaaacatcgctgccaatggacatgtgctccaatttcgatgcagatgagatc
cgtcgcctgggcaaacgtttccgtaaactcgatctggacaattcgggagcgttgagcata
gatgagtttatgtcgctgccggaactgcaacagaatccgcttgtacagcgcgtcatcgat
atattcgatgcggatggcaatggtgaggtcgatttcaaggaattcatccagggcgtctca
cagttcagtgtgcgcggcgataagctatccaaattgcgtttcgcattccgcatctacgat
atggacaatgatggttatatctcaaacggtgagctctttcaggtgctcaaaatgatggtt
ggcaacaatttgaaggatacgcaactgcaacagattgtcgacaagacaatctgtttcgcc
gacaaggatgaggatggcaaaatatcattcgatgagttctgttccgtcgtgggcaatacg
gatatacataagaaaatggttgttgatgtttaa

DBGET integrated database retrieval system