KEGG   Drosophila virilis: Dvir_GJ14779Help
Entry
Dvir_GJ14779      CDS       T01066                                 

Definition
GJ14779 gene product from transcript GJ14779-RA
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
dvi  Drosophila virilis
Pathway
Wnt signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:dvi04310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 170 aa AA seqDB search
MGNETSLPMDMCSNFDADEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVID
IFDADGNGEVDFKEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTICFADKDEDGKISFDEFCSVVGNTDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacgaaacatcgctgccaatggacatgtgctccaatttcgatgcagatgagatc
cgtcgcctgggcaaacgtttccgtaaactcgatctggacaattcgggagcgttgagcata
gatgagtttatgtcgctgccggaactgcaacagaatccgcttgtacagcgcgtcatcgat
atattcgatgcggatggcaatggtgaggtcgatttcaaggaattcatccagggcgtctca
cagttcagtgtgcgcggcgataagctatccaaattgcgtttcgcattccgcatctacgat
atggacaatgatggttatatctcaaacggtgagctctttcaggtgctcaaaatgatggtt
ggcaacaatttgaaggatacgcaactgcaacagattgtcgacaagacaatctgtttcgcc
gacaaggatgaggatggcaaaatatcattcgatgagttctgttccgtcgtgggcaatacg
gatatacataagaaaatggttgttgatgtttaa

DBGET integrated database retrieval system