KEGG   Drosophila virilis: Dvir_GJ14803Help
Entry
Dvir_GJ14803      CDS       T01066                                 

Definition
GJ14803 gene product from transcript GJ14803-RA
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dvi  Drosophila virilis
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:dvi03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 446 aa AA seqDB search
MGDFDLNVDSLIQRLLENFKKQKEAEEHAQKLIIAQQLAASGGSGSDGGVSASSSAACLV
GGGTPNSACSGATASDQLDELTEQQRRMLQQYSISPPSETMISADGDQITVHHPREEPKK
SRLKLRDFFVAEFVRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDI
HGQYTDLLRLFEYGGFPPTANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNH
ECASINRIYGFYDECKRRYNVKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQ
IRRLMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGVDVVSKFLNRHELDLIC
RAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMTVDDTLMCSFQILKPSEKKAKY
LYSGINSSRPTTPQRSAPMLATNKKK
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgggcgattttgatttaaatgtggacagtctaatacagcggctgctggaaaatttcaaa
aaacaaaaagaggccgaggagcatgcacagaagctgatcattgctcaacaattggccgct
tctggcggcagcggcagcgacggcggcgtctctgcctcgagctcagctgcctgtttagtg
ggcggcggcacgcccaacagtgcctgcagcggggcaacggcaagcgatcagctggacgag
ctcaccgaacagcagcgccgcatgctgcaacagtactcgatatcgccgcccagcgagaca
atgatatcggctgatggggaccaaataacggtgcatcatccgcgcgaggagcccaagaaa
tccagattgaaattgcgcgatttcttcgttgccgaatttgtgcgcagctgccgcaccggc
aaacaggtgcagatgacggaggcggaggtgcgcggcttgtgcttgaagtcgcgcgagata
ttcttgcaacagccgatattgctggaactggaggcgccattgatcatctgtggcgatata
cacggccagtacacagatctgttgcgtctattcgaatacggcggatttccaccgactgcc
aactatctgtttcttggcgactatgtggatcggggcaagcaatctctggagacgatctgt
ttgctgttggcctacaagatcaaatatccggagaatttcttcttgttgcgcggcaatcat
gagtgcgccagtattaatagaatttatggcttttacgacgagtgcaagcgtcgctacaat
gttaaactatggaagaccttcacagattgtttcaactgtctgcctgtggccgcgattatt
gatgagaagatcttctgttgccatggtggcctcagtcccgatctgcagggcatggagcag
atccgtcgcctgatgcgtcccacagatgtgcccgacaccgggctgctctgcgacctgctg
tggagtgatcccgacaaggatgtacagggctggggcgaaaacgatcgtggcgttagcttc
acttttggcgttgatgtcgtctccaagttcttgaatcgacacgagctggacttgatttgt
cgtgcacatcaggtcgttgaggatggctacgagttctttgcgcgccgtcagctggtcaca
ttgttctcggcgccaaactattgcggcgaattcgacaacgctggcggcatgatgaccgtg
gacgacacgctcatgtgctcattccagatattgaagccatccgaaaagaaggccaagtat
ttgtacagcggcattaactcatctcggccaacaacaccgcagcgcagcgctccaatgttg
gcgaccaacaagaagaaataa

DBGET integrated database retrieval system