KEGG   Drosophila virilis: Dvir_GJ14803Help
Entry
Dvir_GJ14803      CDS       T01066                                 

Definition
GJ14803 gene product from transcript GJ14803-RA
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dvi  Drosophila virilis
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    Dvir_GJ14803
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Dvir_GJ14803
Protein phosphatases and associated proteins [BR:dvi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     Dvir_GJ14803
Transcription machinery [BR:dvi03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     Dvir_GJ14803
Spliceosome [BR:dvi03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Dvir_GJ14803
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 446 aa AA seqDB search
MGDFDLNVDSLIQRLLENFKKQKEAEEHAQKLIIAQQLAASGGSGSDGGVSASSSAACLV
GGGTPNSACSGATASDQLDELTEQQRRMLQQYSISPPSETMISADGDQITVHHPREEPKK
SRLKLRDFFVAEFVRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDI
HGQYTDLLRLFEYGGFPPTANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNH
ECASINRIYGFYDECKRRYNVKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQ
IRRLMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGVDVVSKFLNRHELDLIC
RAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMTVDDTLMCSFQILKPSEKKAKY
LYSGINSSRPTTPQRSAPMLATNKKK
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgggcgattttgatttaaatgtggacagtctaatacagcggctgctggaaaatttcaaa
aaacaaaaagaggccgaggagcatgcacagaagctgatcattgctcaacaattggccgct
tctggcggcagcggcagcgacggcggcgtctctgcctcgagctcagctgcctgtttagtg
ggcggcggcacgcccaacagtgcctgcagcggggcaacggcaagcgatcagctggacgag
ctcaccgaacagcagcgccgcatgctgcaacagtactcgatatcgccgcccagcgagaca
atgatatcggctgatggggaccaaataacggtgcatcatccgcgcgaggagcccaagaaa
tccagattgaaattgcgcgatttcttcgttgccgaatttgtgcgcagctgccgcaccggc
aaacaggtgcagatgacggaggcggaggtgcgcggcttgtgcttgaagtcgcgcgagata
ttcttgcaacagccgatattgctggaactggaggcgccattgatcatctgtggcgatata
cacggccagtacacagatctgttgcgtctattcgaatacggcggatttccaccgactgcc
aactatctgtttcttggcgactatgtggatcggggcaagcaatctctggagacgatctgt
ttgctgttggcctacaagatcaaatatccggagaatttcttcttgttgcgcggcaatcat
gagtgcgccagtattaatagaatttatggcttttacgacgagtgcaagcgtcgctacaat
gttaaactatggaagaccttcacagattgtttcaactgtctgcctgtggccgcgattatt
gatgagaagatcttctgttgccatggtggcctcagtcccgatctgcagggcatggagcag
atccgtcgcctgatgcgtcccacagatgtgcccgacaccgggctgctctgcgacctgctg
tggagtgatcccgacaaggatgtacagggctggggcgaaaacgatcgtggcgttagcttc
acttttggcgttgatgtcgtctccaagttcttgaatcgacacgagctggacttgatttgt
cgtgcacatcaggtcgttgaggatggctacgagttctttgcgcgccgtcagctggtcaca
ttgttctcggcgccaaactattgcggcgaattcgacaacgctggcggcatgatgaccgtg
gacgacacgctcatgtgctcattccagatattgaagccatccgaaaagaaggccaagtat
ttgtacagcggcattaactcatctcggccaacaacaccgcagcgcagcgctccaatgttg
gcgaccaacaagaagaaataa

DBGET integrated database retrieval system