KEGG   Drosophila virilis: Dvir_GJ14863Help
Entry
Dvir_GJ14863      CDS       T01066                                 

Definition
(RefSeq) GJ14863 gene product from transcript GJ14863-RA
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
dvi  Drosophila virilis
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dvir_GJ14863
  Amino acid metabolism
   00220 Arginine biosynthesis
    Dvir_GJ14863
   00330 Arginine and proline metabolism
    Dvir_GJ14863
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Dvir_GJ14863
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 376 aa AA seqDB search
MIVDSGESEWRQLSCQVPSDRDTDRTGSMWWTRKLANKWLQRRCLSAACEQNRLGIIGVP
FAKGQTKQGVELAPDLLRQNRLRQVLQSSDERLLITDYGNLQYAVDESLLQQQRQHYHHI
HNYADFMACNLALIGQVQLMLRENAQFLAIGGDHAIGFGSVAGHLQHTPNLSLVWIDAHA
DINLHSTSQSGNIHGMPVSFLLPQLRATWQHAALDKIAPNCLPKDQLVYIGLRDIDPYEA
FILNKFGIRYYAMDSIDRVGVPKIIEMTLDALSPRNKIHVSFDIDALDSNVAPSTGTAVR
GGLTLREGISIVEALRDTKRVQGMDLVEINPKLGSERDVRTTVDSGLEILKSMFGYRRSG
ARYYSNLDTGILGREQ
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgatagttgacagcggcgaaagtgagtggcgacagctcagttgtcaagtgccgagcgac
cgagacacagacagaactggcagcatgtggtggacgcgtaaattggccaacaaatggctg
cagcgacgctgcctgagcgcggcgtgcgaacagaatcggctgggcattatcggggtgccg
ttcgccaaggggcagaccaagcagggtgtcgagctggcgccggatctgttgcgacagaac
aggctgcgccaggtgctgcagagcagcgacgagcgactgcttataacggactacggcaat
ttgcagtacgccgtagacgagtcgctgctgcaacagcagcgccagcattaccatcacata
cacaactatgcggactttatggcctgcaatctggccctgatcgggcaggtgcagctgatg
ctgcgcgagaacgcccagttcctggccattggcggcgatcatgccattggctttggctcc
gtggcgggtcatttgcagcatacgccgaatttatcgctggtctggatcgatgcgcatgcg
gacatcaatttgcacagcacctcgcagtcgggcaatatacatggtatgcccgtttcgttc
cttctgccgcagctgcgcgccacctggcagcatgcggcgctcgacaagattgcgcccaat
tgtttgccgaaggatcaattggtttacattggcttgagggacattgacccctatgaggcg
tttatattgaataaatttggaatacgctactatgccatggattccatcgatcgcgtcggc
gtgcccaagatcattgagatgacgctggacgcgctgagtccgcgaaacaagattcatgtt
agcttcgatatcgatgccctggacagcaatgtggcgcccagcacgggcaccgcagtccgc
ggcggcctaaccctccgtgagggcatcagcattgtggaggcgttgcgggacaccaagcgt
gtgcagggcatggatctggtcgagatcaatccgaagctgggcagcgagcgcgatgtccgc
accaccgtcgactccggcttggagatactcaaaagcatgttcggctatcggcgttccggt
gcgcgctactacagcaacctggacacgggcatactgggacgtgaacagtga

DBGET integrated database retrieval system