KEGG   Drosophila virilis: Dvir_GJ14863Help
Entry
Dvir_GJ14863      CDS       T01066                                 

Definition
GJ14863 gene product from transcript GJ14863-RA
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
dvi  Drosophila virilis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dvi01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dvi00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 193 aa AA seqDB search
MWWTRKLANKWLQRRCLSAACEQNRLGIIGVPFAKGQTKQGVELAPDLLRQNRLRQVLQS
SDERLLITDYGNLQYAVDESLLQQQRQHYHHIHNYADFMACNLALIGQVQLMLRENAQFL
AIGGDHAIGFGSVAGHLQHTPNLSLVWIDAHADINLHSTSQSGNIHGMPVSFLLPQLRAT
WQHAALDKIAPNW
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtggtggacgcgtaaattggccaacaaatggctgcagcgacgctgcctgagcgcggcg
tgcgaacagaatcggctgggcattatcggggtgccgttcgccaaggggcagaccaagcag
ggtgtcgagctggcgccggatctgttgcgacagaacaggctgcgccaggtgctgcagagc
agcgacgagcgactgcttataacggactacggcaatttgcagtacgccgtagacgagtcg
ctgctgcaacagcagcgccagcattaccatcacatacacaactatgcggactttatggcc
tgcaatctggccctgatcgggcaggtgcagctgatgctgcgcgagaacgcccagttcctg
gccattggcggcgatcatgccattggctttggctccgtggcgggtcatttgcagcatacg
ccgaatttatcgctggtctggatcgatgcgcatgcggacatcaatttgcacagcacctcg
cagtcgggcaatatacatggtatgcccgtttcgttccttctgccgcagctgcgcgccacc
tggcagcatgcggcgctcgacaagattgcgcccaattggtga

DBGET integrated database retrieval system