KEGG   Drosophila virilis: Dvir_GJ14864Help
Entry
Dvir_GJ14864      CDS       T01066                                 

Definition
GJ14864 gene product from transcript GJ14864-RA
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
dvi  Drosophila virilis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dvir_GJ14864
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dvir_GJ14864
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Dvir_GJ14864
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 124 aa AA seqDB search
MDSIDRVGVPKIIEMTLDALSPRNKIHVSFDIDALDSNVAPSTGTAVRGGLTLREGISIV
EALRDTKRVQGMDLVEINPKLGSERDVRTTVDSGLEILKSMFGYRRSGARYYSNLDTGIL
GREQ
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggattccatcgatcgcgtcggcgtgcccaagatcattgagatgacgctggacgcgctg
agtccgcgaaacaagattcatgttagcttcgatatcgatgccctggacagcaatgtggcg
cccagcacgggcaccgcagtccgcggcggcctaaccctccgtgagggcatcagcattgtg
gaggcgttgcgggacaccaagcgtgtgcagggcatggatctggtcgagatcaatccgaag
ctgggcagcgagcgcgatgtccgcaccaccgtcgactccggcttggagatactcaaaagc
atgttcggctatcggcgttccggtgcgcgctactacagcaacctggacacgggcatactg
ggacgtgaacagtga

DBGET integrated database retrieval system