KEGG   Drosophila virilis: Dvir_GJ14922Help
Entry
Dvir_GJ14922      CDS       T01066                                 

Definition
(RefSeq) GJ14922 gene product from transcript GJ14922-RB
  KO
K16172  
insulin receptor substrate 1
Organism
dvi  Drosophila virilis
Pathway
FoxO signaling pathway
mTOR signaling pathway
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dvir_GJ14922
   04150 mTOR signaling pathway
    Dvir_GJ14922
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Dvir_GJ14922
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 931 aa AA seqDB search
MPIEFGLLKTRKLTMASSDNGVILSEYQKKLKTMKKKFFVLHRETINSAARLEYYDTEKK
FIQNAEPKRVIYLKSCFNINQRYDTKHKFVLALSSREGGFGMVLNSESDLRRWLDNLLSI
QRENTTGTDQGYTSYEYVWQVIVQKKGMSAHVGITGSYHCCLTSKSLTFICIGPEKLANG
DNRIVKVEILLTTIRRCGHASPQNIFYMELGRQSVLGSGELWMETEDSAIAKHMHDMILS
AMSAKSESNMNLLNVYKGQSDLSSEPMRKRSSSANEASKPINVLQKRQNQTEIRNSFSPQ
YNSYGRERCDSLPTRNRTLSECSNQTYIALKHGHRCNTISGSRPYFIQRHTDSPPTYSMK
CSESEESSVSIDEANEKSNFDAYRINSRTSKAMIPEENIDEDVQDNSKVVRINGTGPIRG
SNSLFNVADEDFKIDFPEHSPAKLEQDADIDNKCERPSRAYSIGSRVEHFKLSKLLGNIN
ELDNTSPRVRAYSVGSKSKIPRCDIQRGVLFSKLTNGHHHKGSICNVDVQTCSEIIGLNT
PKEIKSTSAPLLNLRNYISPVRMSDLMEIDFSKVTQVSNTSQQQRMFKNCQVPVMQTETL
AQKRIASDSPNSYGNIKRIEMNQQNDLTSKFKVTKCGENSDTGYLEMKPVGKVCPNSKQL
SLDDQMEKLRLQNQCLRLGAMQDEPRNNNSGCCVMSERNGDLKESQHPTNINIYNAENVD
KIFLTSKDHTKLEKNKTENAILNCGLDIGNSATVGRKLIHSISNEDYTKHVTKSNASDIK
EVGYQILQIKSDSSLISKKKNQRPSYKQQISRQIHLEGLKNVDRNEAILNTPTKCKLLNE
KESNVLNEDAFSEHILDQGATGLSSELCEYELYYASLDLPQCSGQMATNSHTKVSCESSP
TPICFESNSSYAKIDFDQSDSSSASSKICNI
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atgccaattgaattcggattattaaagacacgaaaattaacaatggcttcgtccgacaac
ggagtcatactaagtgaatatcaaaaaaaattaaaaacaatgaaaaaaaagttttttgtt
ctgcacagagaaacaattaattcagctgcacggttggaatattacgatactgaaaaaaaa
tttatccaaaatgcagagccaaaacgagttatttatttgaagagctgttttaacattaac
cagcgatatgatactaaacataagtttgtattagctctgtcatcaagagaaggcggcttt
ggaatggtgttgaattctgaaagtgatttacgaagatggttagacaacttattatccata
caacgcgaaaacacaacaggaactgatcaagggtatacatcatatgaatatgtttggcaa
gttattgttcaaaagaaaggaatgtccgcacatgttggaatcactggaagttatcattgc
tgcctaacttcaaaatcactgacatttatatgtattggaccggaaaaattagcgaatgga
gataatcgaattgttaaagttgaaatacttttaacaactattagaagatgtggacacgct
tccccacaaaacattttttatatggaactaggccgacagagtgtgttgggttccggtgaa
ctatggatggaaacagaagattccgcaattgctaaacatatgcacgatatgatattaagc
gcaatgtcagctaagtctgagtcgaatatgaatttgttaaatgtatacaaaggacagtca
gatttaagcagtgagccgatgaggaaacgttcgtcatcagcaaatgaagcatcaaagcct
attaacgttttacagaaacgacaaaatcaaactgaaataagaaacagtttttctccacag
tataacagttatggacgtgagcgttgcgacagtttgccaactagaaatcggacactaagt
gaatgtagtaatcaaacatatattgcattgaaacatggacatcgatgtaacactatatcc
ggatcaaggccgtattttatccaaagacataccgacagtccaccaacttactcaatgaaa
tgctctgaaagtgaagagtcttcagtaagcattgacgaagccaatgagaaatccaacttt
gacgcttatcgaataaactcaaggacatcaaaagcgatgatacctgaagaaaatattgat
gaagatgttcaagacaacagcaaagttgtacgaataaacggtactggcccgattcgagga
tcaaactcattattcaatgttgccgatgaagactttaagatcgattttcccgagcattca
cctgcaaaactagaacaagatgccgatatcgataacaagtgcgaacgtccaagtcgagct
tattcgattggaagtagggtagaacactttaaattgagtaaacttcttggaaatataaat
gagctggataatacttcaccgcgggttcgagcgtattcagttggatcaaagtcaaaaata
ccacgttgcgatatccagcgaggtgttcttttttcaaagttaacaaacggtcatcatcat
aaaggaagtatttgtaatgtagatgttcaaacatgcagtgaaattatcggactaaatact
ccaaaagaaattaaatctacgagtgctccacttttaaatttaagaaattacattagtcct
gtccgcatgagtgatttaatggaaattgatttttccaaagttactcaggtatccaacact
tcacaacagcaaagaatgtttaaaaattgtcaagtacctgtaatgcaaactgaaactcta
gctcaaaaaaggattgccagcgatagtccgaattcatatggcaatatcaagcgtattgaa
atgaatcagcaaaatgatttgactagtaagtttaaagtaacaaaatgtggagaaaactcc
gatactggatatttagaaatgaaaccagttggcaaagtgtgccctaattccaagcaatta
agtcttgatgaccagatggaaaagctaaggttacaaaatcaatgcttacgattgggagca
atgcaggatgaacctaggaataataatagtggttgctgtgttatgtcagaaagaaatgga
gatttgaaagagtctcaacaccctacaaatataaatatatataatgccgaaaatgttgac
aaaattttcctaacaagtaaagatcataccaagctggaaaaaaataaaacggaaaatgca
atattaaattgtggcttggatataggtaattctgccacagtgggtagaaaactaatacat
tctattagtaacgaagactacacgaagcatgtaaccaaatcaaatgcatctgacatcaag
gaagttggctaccaaattcttcaaatcaaaagtgatagttctcttatttcaaagaaaaaa
aatcaaaggccatcttataaacaacaaataagtcgacaaattcatttagaaggtttgaaa
aacgttgatcgaaatgaggcaatattaaatacgcccactaaatgtaaattattaaacgaa
aaagaatcaaatgttttaaatgaggatgcattttcagagcatattctagatcagggtgcg
actggattgtcttcagaattgtgcgaatatgaactatattatgcaagcttagacctccca
cagtgtagtggacaaatggcaacaaatagccatacaaaagtgtcatgtgaatcttcgcca
acaccaatttgctttgagagtaacagttcatatgcaaaaattgattttgatcaatcggat
tcatcgtctgcttcatcaaaaatttgtaatatctaa

DBGET integrated database retrieval system