KEGG   Drosophila virilis: Dvir_GJ15045Help
Entry
Dvir_GJ15045      CDS       T01066                                 

Definition
GJ15045 gene product from transcript GJ15045-RA
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.1.2.15]
Organism
dvi  Drosophila virilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 864 aa AA seqDB search
MAVKQNNNEQNEMAPGQAGGGGGGGSAANMGAGGAGAGAGGAASPNGKSLMPGNISDEGG
GGGGGQANDASSQTTSGKSQTNARELGGASGTGTGSSSTNTTDRQHDFNALLNIMQGIDP
EDQKASRIYKLVIYNLAGMHVSSAPADLKLFKENITKIGQLLAVPNKKRYLMIYLRFVYH
LITQSAEPPSCAVAIVFHLFSPDLIIEAVQSLLDLNVQDDSIRKTVGLLCKWIHVCNFCQ
NLNLWIMALLHGLREQEKYLLLDEIALDNIEHLFRLMIFPALRPKVAPIVFHMLSTINQT
PEIFHKILPSIPLVIGAMKSKPNNLDNASSDARNYIQKLVDLFNALMIRFYDNDELYAPF
KATLQMYEPSQNCMAFARALFENALPRNARVGLVNLGNTCYMNSVLQALAMTSDFVRQIL
LIESGSMLLQKVQQQIALMHHSMRYELTPLRVLKATRPPGFTPGLQQDSSEFLGYLLDLL
HEHEINSGAAQHMDTDVGQPKEVKTSSEPALLTDEIVAAGVIPYNSNDHVHNSRPSAPAI
GPATPTSMPTNAAPKKPSTIDKTFAGKLSTTYKCLSCAWESRNEDSFRELQLSFPDDKVD
CGATNYSVQDLIDYYCSPEKLDGDNQYFCARCKKLCDAERRIAITQAPRNLILTLKQFKY
DQKYHFRTKLMHKVFHDESVIVKVCANDSLQETCTVHYDLYAGVVHAGYSMDSGHYFTFA
ADQSKNWFKFNDSLVTNSKPQEMHSLTSPNTPYILFYQMCGRSTEATPDGPMHPMVPVPL
VPPLTLDELPRGLRDYVKNDNRDYSEELKLQRFKRNAKRNTMSGNVTMNGRNGYEGDDED
DHMPPPAGGCGGNDMGMNINRFVY
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcaagcagaacaacaacgagcagaacgagatggcgcccggccaagctggcggc
ggtggcggcggcggctcagccgccaatatgggtgcaggaggtgctggagcaggagcaggt
ggagctgcgtctcccaatggcaaatccctaatgccgggcaacatttcagacgaaggcggt
ggcggcggcggcgggcaggccaacgatgctagcagccagacaacgtctggcaaatcccag
acaaacgctcgggaactgggcggagcgagcggcactggaactggcagcagcagcaccaac
accaccgaccggcagcacgatttcaatgcgctgctcaacataatgcagggcatcgatccg
gaggatcagaaggcgtcgcgcatctataagcttgtcatctacaatctggccggcatgcat
gtgagcagcgcgccggcagatctgaagctgttcaaggagaacatcaccaaaatcggccag
cttctggcggtgcccaacaagaagcgctatctgatgatctatctgcgcttcgtctaccat
ctgatcacacagtccgcggagccgccctcgtgcgccgtggccattgtgttccacctattc
agtccggatctgatcattgaggcggtgcaatcgctgctcgatctgaatgtccaggacgat
agcatacggaagacggtcggcttgctctgcaaatggatacatgtttgcaatttttgccaa
aatctcaatctctggattatggccctgctgcacggactgcgcgaacaggagaaatatctg
ctgctcgatgagatcgcgctcgataatatcgagcatctgttcaggctcatgatctttccc
gctttgcgtcccaaggtggcgcccattgtctttcacatgctctccactatcaatcagacg
cccgaaatattccacaagatattgccaagcataccgctggtgattggcgccatgaagagc
aagccaaataacctggataacgccagcagcgatgcgcgcaactatatccaaaagctggtc
gacttgttcaatgcgctgatgatacgcttctatgacaacgatgagctctatgcaccattc
aaggctactctgcagatgtacgagccctctcagaattgcatggcatttgcccgtgcgctg
ttcgagaatgcgctgccacggaatgcacgcgtcggtctggtcaatctgggcaatacctgc
tacatgaacagcgtgctccaggcgctggccatgaccagcgactttgtgcggcaaatcctg
ctcatcgagagcggttcgatgttgttgcagaaggtgcagcagcagatcgcgttgatgcat
cattcgatgcgttacgagctgacgccgttgcgggtgctgaaggccacacgtccgccgggc
tttacgcccggcctgcagcaggacagctccgagttcctaggctatttgctggacctgctg
cacgagcacgagatcaacagcggggcggcgcagcacatggacacggacgtgggacagccc
aaagaggtcaagaccagcagcgagccggcgctgctgacggatgagatagtggccgccggc
gttataccctataatagcaatgatcatgtgcacaatagcaggccgagtgcgccggctatt
ggcccagccacgcccacatccatgcccaccaacgcagcgccgaagaagccatcgaccata
gacaaaacgttcgccggcaaattgtcaacgacatacaaatgcctgagctgcgcctgggag
agccgcaacgaggacagcttccgcgagctgcagctatcgtttccggacgacaaggtcgac
tgcggcgccaccaactattcggtgcaggatctaatcgactattactgctcgccggagaag
ctcgatggggacaatcaatacttttgtgcacgctgcaagaaactgtgcgatgcggagcgt
cggattgccattacacaggcgccgcgcaatctaatcctcacgttgaaacagttcaaatac
gatcagaaatatcattttcgcaccaagctcatgcacaaggtgttccacgatgagagcgtg
attgtcaaggtgtgcgccaacgattcgctgcaggaaacgtgcaccgtacactacgatctg
tatgcgggcgtcgttcatgccggctacagcatggactctgggcattatttcacctttgcc
gccgatcagtccaagaattggttcaagttcaacgacagcctggtgaccaattcgaagccc
caggaaatgcacagtctgacctcaccgaacacaccctacattctgttctatcagatgtgc
ggtcggtccaccgaagccacacccgatggacccatgcatccgatggtgccggtgcccctg
gtgccgcccctcacgcttgacgagctgccgcgcggtctgcgcgattatgtaaaaaacgat
aatcgggattacagcgaggagcttaagttgcagcgcttcaaacggaatgccaaacggaac
acgatgagcggcaatgttaccatgaatggtcgcaatggctacgagggcgacgacgaggac
gaccatatgccgcccccggcgggcgggtgtggcggcaacgatatgggcatgaatatcaat
cgttttgtgtactga

DBGET integrated database retrieval system