KEGG   Drosophila virilis: Dvir_GJ15047Help
Entry
Dvir_GJ15047      CDS       T01066                                 

Definition
GJ15047 gene product from transcript GJ15047-RA
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     Dvir_GJ15047
Protein kinases [BR:dvi01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   Dvir_GJ15047
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 412 aa AA seqDB search
MRIFPVRLSAVSSSMSSLAKMLDFYSGFNPSPLSIKQFMDFGQNACEKKSFIFLRKELPV
RLANIMKEIALLPDNLLHTRSVSEVSSWYVKSFEDVLEYEKIEPTHENLQKFVRDLDLIR
NRHNDVVQTMAQGVIEMKENEGGHVDAPTESSIQYFLDRLYMSRISIRMLINQHTLLFGS
SPHSLGRHIGCLDPACDLSDVVRDAYENARFLCDQYYLTSPALEIQQYSSTDEGTPIRTV
YVPSHLYYMLFELFKNSMRAVVEHHNHDNCDTLPPLKVAICRGKEDICVKISDQGGGIPR
SQSDQLFKYMYSTAPQPSKSDLHTVPLAGYGYGLPISRLYARYFHGDIVLLSCEGFGTDA
IIYLKALSDEANELLPIFNKTSSKFYRATVPTGDWSNQVKYAKKKKTSAVSQ
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatttttcccgtacgactctcggccgtctcgtcgtccatgtcgagcttggccaaa
atgttggatttctactcgggcttcaatccgtcgccgctttcaatcaaacagtttatggat
ttcgggcaaaatgcgtgcgaaaagaaatcgtttatatttctgcgcaaggagctgcccgtg
cggctggcgaatatcatgaaggagatcgccttgctgccggataatctgctgcacacgcga
tccgtgagcgaggtgagctcctggtacgtgaagagtttcgaggatgtgctggagtacgag
aagatcgaacccacccacgagaatctgcaaaaatttgtgcgcgatttggatctcattagg
aatcgccacaacgatgttgtccagacgatggcgcagggcgtcatcgagatgaaggagaac
gagggcggccacgtggacgcgcccaccgaaagctccatacaatactttctcgatcggctc
tacatgtcccgcatcagcatacgcatgctcatcaatcagcacaccctgctcttcggctcc
agcccgcactcgctgggccggcacatcggctgcctggatcccgcctgcgatttgtcggac
gtggtgcgcgatgcgtacgagaatgcgcgctttctctgtgatcaatactatctgaccagc
cccgcgctggagatccagcagtacagcagcacggacgagggtacacccatccggaccgtg
tacgttccgtcgcatttgtactatatgctctttgagctgttcaagaactcgatgcgcgcc
gttgtcgagcatcacaatcatgacaattgtgatacgttgccgccgctcaaggtggccatt
tgtcgcggcaaggaggacatctgtgtaaagatctccgatcagggcggcggcataccgcgc
tcccagtccgatcagctcttcaagtacatgtacagcacggcaccgcagccctcaaaatct
gatctgcatacggtacccttggccggctacggttacggcctgcccatctcccggctctat
gcgcgctatttccatggcgacattgtgctgctctcctgcgagggttttggcaccgatgcc
attatctacctgaaggcgctttccgatgaggccaacgagctgttgcccatcttcaacaaa
acgagctcaaagttctatcgggccacggtcccaaccggcgactggtccaatcaggtaaaa
tacgctaagaagaagaagacgagcgccgtcagccaatag

DBGET integrated database retrieval system