KEGG   Drosophila virilis: Dvir_GJ15085Help
Entry
Dvir_GJ15085      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein, isoform C
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
dvi  Drosophila virilis
Pathway
dvi00220  Arginine biosynthesis
dvi00250  Alanine, aspartate and glutamate metabolism
dvi00471  D-Glutamine and D-glutamate metabolism
dvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dvir_GJ15085
   00220 Arginine biosynthesis
    Dvir_GJ15085
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Dvir_GJ15085
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Dvir_GJ15085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glutaminase Ank_2 Ank_4 Ank Ank_5 Ank_3
Motif
Other DBs
NCBI-GeneID: 6636316
NCBI-ProteinID: XP_002059876
FlyBase: FBgn0202284
UniProt: B4MFP2
Position
Unknown
AA seq 730 aa AA seqDB search
MFKGVPTLANLNLRLLTGHTAKGRAFSAALINGQVLVRRSKATATSLDLADANGKRSKID
VDVYSEQELLKRAKFRHSGYEVQQKIASEKKLRTPPLLNLVFANRKLSFYDTSSGPKPCE
ENAKLNQRRNYSIRPHREQEQRNAEDVLFDMFASEETGLISMGKFLAGLKTTGIRRNDPR
VRELMDNLKKVHKLNNYETGSSAETQHLNRETFKAVVSPNIVLIAKAFRQQFVIPDFSSF
VKDIEDIYIRCKSNTEGKLADYIPQLARYSPNFWGVSICTIDGQRFSIGDVEEPFTLQSC
SKPLTYAIALEKLGPKVVHSFVGQEPSGRIFNELVLDQNKKPHNPMINAGAILTCSLMNA
LVKPDMTSAEIFDYTMSWFKRLSGGEYIGFNNAVFLSEREAADRNYALGFYMRENKCFPK
RTNLKEVMDYYFQCCAMETNCEAMSVIAASLANGGICPTTEEKVFRPEVIRDVLSIMHSC
GTYDYSGQFAFKVGLPAKSGVSGGMMLVIPNVMGIFAWSPPLDQLGNTVRGLQFCEELVN
TFNFHRYDNLKHLSNKKDPRKHRYETKGLSIVNLLFSAASGDVTALRRHRLSGMDITLAD
YDGRTALHLAASEGHLECVKFLLEQCHVPHNPKDRWGNLPVDEAENFCHSDVVDFLKRWA
ENAKDAPQECITESVTTKTAADEELPCNTTELASSPLPPAESEPRSSSPVSSEAGSTASL
ASVDKTKPGL
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaggtgtcccaacgcttgcgaatttgaatttgcgtttgcttaccggccacacg
gccaaaggccgtgcgttttccgctgcattgattaatggccaggtgctggtgcgacgctcg
aaggcaacggcaacatctctcgacctggccgatgccaatggcaaacgcagcaagatcgac
gtcgatgtgtacagtgagcaggagctgctgaaacgcgccaagtttaggcattccggctac
gaggtgcagcagaaaatcgcatctgagaagaaactgcgaaccccgccgctgctgaatctg
gttttcgccaatcgcaaattatccttctatgacaccagctccggacccaagccctgcgag
gagaatgccaagctaaatcagcgacgcaactattcgataaggccccatcgggagcaggaa
caacgcaatgcggaggatgtactcttcgatatgtttgccagcgaggagacgggtcttata
tccatgggcaaattcctggccggactgaagacgacgggcatacgacgcaatgatccgcgt
gtgcgtgagctcatggacaatctgaagaaggtgcacaagctgaacaactatgagacgggc
tcgtccgcagagacgcagcatctcaaccgggagaccttcaaggccgtggtctcgccgaat
attgtgctgatagccaaggcgttccgtcaacagtttgtcatccccgacttctcgagcttc
gtcaaggacattgaggacatctatattcgctgcaaaagcaataccgagggcaaactggcc
gactacattccccaactggcccgctatagtcccaatttctggggcgttagcatctgcact
atcgacgggcaacgcttctccattggcgacgtcgaggagcccttcaccctgcagagctgc
agcaagcccctgacctatgccattgcactggagaaactgggtcccaaggttgtccattcg
tttgtcggccaggagccgagtggacgcattttcaacgaactcgtgctcgatcagaataag
aagccgcacaatcccatgatcaatgccggggccatacttacctgctcgctgatgaacgcc
ttggtcaagccggatatgacctccgccgagatcttcgactacaccatgtcctggttcaag
cgtctgtccggcggcgaatacattggcttcaacaacgccgtattcctttcggagcgcgag
gcagcggatcgtaactacgcccttggtttttatatgcgcgagaacaagtgcttcccgaag
cggaccaacctgaaggaggtgatggactactatttccagtgctgcgccatggagacaaac
tgcgaagccatgtctgtgatagccgccagtctggccaatggcggcatttgtccgaccacc
gaggagaaggtctttcgcccggaagtcatacgggatgtgctctccataatgcactcctgt
ggcacctacgactactccggtcagttcgccttcaaggtgggcctgccggccaagtcgggc
gtcagtggcggcatgatgctggtcataccgaatgtgatgggcatatttgcctggtcgccg
ccactcgatcagctgggcaatacggtgcgtggcctgcagttctgcgaggagctggtcaac
acgttcaatttccatcgttacgacaatctgaagcatctgtccaataagaaggatccgcgt
aagcatcgctacgagaccaagggcctgtccattgtcaatctgctcttctccgccgccagc
ggcgatgtgaccgcactgcgtcgccatcgtctgtccggcatggacatcaccctggccgat
tacgatggacggacagcgctccatttggccgcctcggagggtcacttggagtgtgtcaaa
tttctgctggagcagtgccatgtgccgcacaatcccaaggatcgttggggcaatctgccc
gtcgacgaggccgagaacttctgccactcggacgtggtcgacttcctcaagcgctgggcc
gagaatgccaaggatgcgccgcaggagtgcatcactgaatcggtgacaaccaaaaccgct
gccgatgaggagttaccctgcaacacgaccgagctggcaagcagtcccttaccccctgcg
gagtctgagccccggagcagcagtcccgtctcctcggaggctggcagcacagcgagcctg
gccagcgtggacaagaccaagccgggcctctag

DBGET integrated database retrieval system