KEGG   Drosophila virilis: Dvir_GJ15246Help
Entry
Dvir_GJ15246      CDS       T01066                                 

Definition
GJ15246 gene product from transcript GJ15246-RA
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
dvi  Drosophila virilis
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dvir_GJ15246
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     Dvir_GJ15246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 687 aa AA seqDB search
MTANPVQRPDRQQSETATETVTEPESELEPVLKSGMTTESGEAITAQSELIGIFYVENRR
RKQNIKIMVKLCPDGIYLRRETAENDHINEQLIRIDDIVGSSYGKRLKKRARGGLNSCKS
ANHEPQEAADEDEEQQQQQQREQQKSTKRRQPGQTQADNSAYLYIYAYLKKEKPLRRVQT
LRILRFRTSDHYAENLNTARLWHHTIREHKQRAAGKLARDPGKKLLILLNPKSGSGKGRE
QFQKQVAPLLREAEAQYDLQITTHPHYAQEYVRSRKDLLERYAGIVVASGDGLFYEVLNG
LMERMDWRRACRELSLGIIPCGSGNGLAKSIAHHCNEPYEPKPILHATLICMTGRATPMD
VVRVELNHRDKHFVMYSFLSIGWGLIADIDIESERLRSIGAQRFTLWAIRRLITLRCYPG
KLFYLPASTKHTEGSAELAAKAATAVESAPESPVETVEPHPVATRTFSEFKDLPDESDVQ
LRAHESDLDQFADALSMDRSVYRQNGDSWHSAVSRRTAYYSVGGQSTRSNRSRLSVAQRI
EAANAEFSQLVPASTMPGLQLPLPAADGWLSEAGEFVMVHAAYTTHLASDCFFAPDSRLN
DGLIYLVIIRAGVGRSQLLNFLLSMHNGTHLPVEEDPHIQVLPVRAFRIEPSGSNGILTI
DGERVDYGPIQAEVFPGLINVMTNTGQ
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgacagccaacccagttcagcgacccgacagacaacagtcggagacggcgacggagacg
gtaacggagccggaatcggagctagagccggtgctgaagtcgggaatgacaacagagtcc
ggagaagcgattactgcgcagtcggagctaatcggtatattctatgtggagaatcggcga
cgcaaacagaatatcaaaatcatggtcaagctctgcccagatggcatctatttgcggcgc
gagacagctgagaatgatcacatcaatgagcagctgatacggatcgatgacatcgttggc
tccagttatggcaagcggctaaagaagcgtgcacgcggcggccttaactcctgcaagagt
gccaaccacgagccgcaggaggcggctgacgaggatgaggaacagcagcagcagcagcaa
cgggagcaacagaaatccacgaaacgccggcagccggggcaaacgcaagcggataacagc
gcctatctgtacatctatgcctatctgaagaaggagaagccgctgcgtcgtgtgcagaca
ttgcgcatcttgcgattccggacgagcgatcactatgccgagaatctgaataccgcgcgg
ctctggcatcacacgatacgagagcacaaacagcgtgcggcgggcaaattggccagagat
ccgggcaaaaagctgctcatattgttgaatcccaagtcgggctcgggcaagggacgcgaa
cagttccagaagcaggtggcgccattgctgcgcgaagcggaggcccaatacgatctgcag
atcacaacgcatccacactatgcccaggagtatgtgcgctcccgcaaagatctgctggag
cgttatgcgggcattgtggtcgcctccggcgatggactcttctatgaggtgctcaacggt
ctgatggagcgcatggattggcgacgcgcctgccgtgaactctcgctgggcatcataccc
tgcggctccggcaacggactggccaagagcattgcccatcactgcaacgagccatacgaa
ccgaagcccatactccatgccacgctcatctgcatgaccggccgggcaacgccgatggat
gtggtgcgcgtcgagctaaatcatcgggataagcactttgtaatgtactcgttcctatcg
atcggctggggcctcatcgccgacattgatattgagagcgagcggctgcgttcgattggc
gcccaacgctttacgctctgggccatccggcggctcatcacgctgcgctgctatccgggc
aagctgttctatctgccagcgagcacaaagcacactgagggatcagcggaattagcagcg
aaagcggcaacagcagtcgaatccgcgccagaatcgcctgtggaaacagttgagccacat
cccgtggcgacgcgaacgtttagcgaattcaaggatttgcccgatgaatcggatgtacag
ctgcgcgcacatgaatccgatttggatcagtttgccgacgcactgtccatggatcgcagc
gtctatcgccagaatggagacagctggcactcggcggtgtcgcgtcgcaccgcctactac
tcggtgggcgggcagagtacacgctccaaccgcagccggctgagtgtggcccagcgcatt
gaagcggccaatgccgagttcagtcagctggtgccggcgagcacaatgcccggattacag
ctgccgctgcccgccgccgatggctggctatcggaggcgggggagttcgtgatggtgcat
gcggcatacacaacgcatctggcatccgattgcttctttgcgccggactcacgcctaaac
gacggcctcatctatctggtgatcatacgagccggcgtcggacgctctcaactgctcaat
tttctgctcagcatgcacaatggcacgcatctgcccgtggaggaggatccccatatacag
gtgctgccggtgcgagcgtttcgcattgagccaagcggctcaaatggcattttaaccatt
gacggcgaacgcgtcgactatggacccattcaggctgaggtatttccaggcctgatcaat
gttatgacaaatacgggccaatga

DBGET integrated database retrieval system