KEGG   Drosophila virilis: Dvir_GJ15246Help
Entry
Dvir_GJ15246      CDS       T01066                                 

Definition
GJ15246 gene product from transcript GJ15246-RA
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
dvi  Drosophila virilis
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dvi00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 687 aa AA seqDB search
MTANPVQRPDRQQSETATETVTEPESELEPVLKSGMTTESGEAITAQSELIGIFYVENRR
RKQNIKIMVKLCPDGIYLRRETAENDHINEQLIRIDDIVGSSYGKRLKKRARGGLNSCKS
ANHEPQEAADEDEEQQQQQQREQQKSTKRRQPGQTQADNSAYLYIYAYLKKEKPLRRVQT
LRILRFRTSDHYAENLNTARLWHHTIREHKQRAAGKLARDPGKKLLILLNPKSGSGKGRE
QFQKQVAPLLREAEAQYDLQITTHPHYAQEYVRSRKDLLERYAGIVVASGDGLFYEVLNG
LMERMDWRRACRELSLGIIPCGSGNGLAKSIAHHCNEPYEPKPILHATLICMTGRATPMD
VVRVELNHRDKHFVMYSFLSIGWGLIADIDIESERLRSIGAQRFTLWAIRRLITLRCYPG
KLFYLPASTKHTEGSAELAAKAATAVESAPESPVETVEPHPVATRTFSEFKDLPDESDVQ
LRAHESDLDQFADALSMDRSVYRQNGDSWHSAVSRRTAYYSVGGQSTRSNRSRLSVAQRI
EAANAEFSQLVPASTMPGLQLPLPAADGWLSEAGEFVMVHAAYTTHLASDCFFAPDSRLN
DGLIYLVIIRAGVGRSQLLNFLLSMHNGTHLPVEEDPHIQVLPVRAFRIEPSGSNGILTI
DGERVDYGPIQAEVFPGLINVMTNTGQ
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgacagccaacccagttcagcgacccgacagacaacagtcggagacggcgacggagacg
gtaacggagccggaatcggagctagagccggtgctgaagtcgggaatgacaacagagtcc
ggagaagcgattactgcgcagtcggagctaatcggtatattctatgtggagaatcggcga
cgcaaacagaatatcaaaatcatggtcaagctctgcccagatggcatctatttgcggcgc
gagacagctgagaatgatcacatcaatgagcagctgatacggatcgatgacatcgttggc
tccagttatggcaagcggctaaagaagcgtgcacgcggcggccttaactcctgcaagagt
gccaaccacgagccgcaggaggcggctgacgaggatgaggaacagcagcagcagcagcaa
cgggagcaacagaaatccacgaaacgccggcagccggggcaaacgcaagcggataacagc
gcctatctgtacatctatgcctatctgaagaaggagaagccgctgcgtcgtgtgcagaca
ttgcgcatcttgcgattccggacgagcgatcactatgccgagaatctgaataccgcgcgg
ctctggcatcacacgatacgagagcacaaacagcgtgcggcgggcaaattggccagagat
ccgggcaaaaagctgctcatattgttgaatcccaagtcgggctcgggcaagggacgcgaa
cagttccagaagcaggtggcgccattgctgcgcgaagcggaggcccaatacgatctgcag
atcacaacgcatccacactatgcccaggagtatgtgcgctcccgcaaagatctgctggag
cgttatgcgggcattgtggtcgcctccggcgatggactcttctatgaggtgctcaacggt
ctgatggagcgcatggattggcgacgcgcctgccgtgaactctcgctgggcatcataccc
tgcggctccggcaacggactggccaagagcattgcccatcactgcaacgagccatacgaa
ccgaagcccatactccatgccacgctcatctgcatgaccggccgggcaacgccgatggat
gtggtgcgcgtcgagctaaatcatcgggataagcactttgtaatgtactcgttcctatcg
atcggctggggcctcatcgccgacattgatattgagagcgagcggctgcgttcgattggc
gcccaacgctttacgctctgggccatccggcggctcatcacgctgcgctgctatccgggc
aagctgttctatctgccagcgagcacaaagcacactgagggatcagcggaattagcagcg
aaagcggcaacagcagtcgaatccgcgccagaatcgcctgtggaaacagttgagccacat
cccgtggcgacgcgaacgtttagcgaattcaaggatttgcccgatgaatcggatgtacag
ctgcgcgcacatgaatccgatttggatcagtttgccgacgcactgtccatggatcgcagc
gtctatcgccagaatggagacagctggcactcggcggtgtcgcgtcgcaccgcctactac
tcggtgggcgggcagagtacacgctccaaccgcagccggctgagtgtggcccagcgcatt
gaagcggccaatgccgagttcagtcagctggtgccggcgagcacaatgcccggattacag
ctgccgctgcccgccgccgatggctggctatcggaggcgggggagttcgtgatggtgcat
gcggcatacacaacgcatctggcatccgattgcttctttgcgccggactcacgcctaaac
gacggcctcatctatctggtgatcatacgagccggcgtcggacgctctcaactgctcaat
tttctgctcagcatgcacaatggcacgcatctgcccgtggaggaggatccccatatacag
gtgctgccggtgcgagcgtttcgcattgagccaagcggctcaaatggcattttaaccatt
gacggcgaacgcgtcgactatggacccattcaggctgaggtatttccaggcctgatcaat
gttatgacaaatacgggccaatga

DBGET integrated database retrieval system