KEGG   Drosophila virilis: Dvir_GJ15330Help
Entry
Dvir_GJ15330      CDS       T01066                                 

Definition
GJ15330 gene product from transcript GJ15330-RA
Orthology
K04447  
Janus kinase 2 [EC:2.7.10.2]
Organism
dvi  Drosophila virilis
Pathway
Jak-STAT signaling pathway
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:dvi04630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1258 aa AA seqDB search
MDDSSSGRTSLADSASLATASLQSGSSSQNIANDGLIHVYNYRRGDYEKFSPSLHCEEIC
TIMCRHMDILPTAVLLFGIREQSNGTETSPMTLKVKHKWQLPGELLNSSVRYCFRMRFRV
PELDRQLPVIDVHCHKYLYHQMRYDMLHEQIAEIRYPEQRDKVMGLAVMDMVIDREEQLL
LAQAVEKAYKSYLPRSLWRAHRIFVRSKIRSTFRRLNSNRPNVDSLKWHYVHQICDLAPT
YLTEQFNATVEYFPNESTTEPPHGNGSIASSTRTSTTTLVTGSNTTLSTTITGPGNQRND
SGSDTHTLRGSQQTPQPSRHRASQQQQLQPNSIPVYVRLFHHDSPEPGLKVARVTSEATL
KWSLVAVVEDIFSLYKESEQLVRLEIVGFPKGYHMRFETEHEMKSFISYLGIYIRLTVKW
MQDLCPSYKTPSLEELERLYCHGPIGGGYSFMKLHENGDKCGSYIVRQCDREYNTYYIDI
NTRIVARNSDHDRCQTETFKIIRKDKQWKLEHKSDEHIFDQLSELAQFIRTDSPDRIRIP
ASKYDKPPLLLLCLPKNLKTKKTEAELSEAELQRRNPQIFNAKTDLQWYRDSINDSDDDK
VYTMRGDWMQQGSFKDVPVTMKMLKYDANFEEFMKLAQTWSLIQSPQFIKLYGLTLSVPY
TMVMEYSKYGPLNKFLQMHRNISMYCLLDVMHGLVRGMHYLEDNKIIHNYIRCSNLYVTK
YDSEKYVLDAKISDPGCPRPYKQSDSPWIPIKYYNNLEGAKQDSSTQLWAFATTIYEIFS
RGQLSLDQLKQRDLIRNRTIDGGILKPLNQRLCPPEMYNTIMDGWSDDPDKRFSHHDIFT
RLNAIKTRLQRNYDVPETEMESFEYSDDHMHCNDDENDFSSEAHASFNGHGLPNGQHHSP
DSDSLTMCNGAVGLSSEFFANSHDLPLVMQLYDCKVIYREKHKIGQGHYGTVYRGELEYH
DKDRPKEQVAIKKLKTVQVTNDFLREIDIMRKLDHPNVVKFKYWAEKSLSIIMEYFEFGS
FIVYLSSRKPSLTNARLLAFALDIAHGMDYLSGKGLIHRDLAARNILVDRSCVKISDFGL
AQFANADGYYYGISQRDIPIKWYSPEAIETLKFSSYSDVWSYGVTLFEMFSRGEIPNLVP
GQDLPQDQFLNRLRQGERLPKPELCSDFVYNELMRPCWHETPKSRPTFQQIIQIITSEIG
DNVGSATGSQQQLQQQQQQQQQQQQQQQQQQQQQLQQQQQPLNRGNSLEDMYKGLTIT
NT seq 3777 nt NT seq  +upstreamnt  +downstreamnt
atggacgacagcagcagcggacgcacctctttggcggacagcgccagcttggcaacagct
tcgctgcagagcggcagctccagtcaaaatattgccaacgatggcctcatccacgtctac
aattatcgcaggggcgactatgaaaagttctcgccgtcgcttcactgcgaggagatatgc
accataatgtgccgccatatggatatactgcccacagcggtgctgctgttcggtatacgc
gagcagagcaacggcaccgagacatcaccgatgacgcttaaagtaaagcacaagtggcag
ctgcccggcgaactgctaaatagcagtgtgcgctactgtttccggatgcggttccgtgtc
ccggaactggacagacagctgccagtgattgatgtgcactgccacaagtatttgtatcac
cagatgcgctacgatatgctgcacgagcagatcgcagagatacgctatccagagcagagg
gacaaagtgatgggtctggctgtaatggatatggtaattgacagggaggagcagctgttg
ctggctcaggctgtcgagaaggcctacaagagctatttgccgcgcagtttgtggcgcgcc
caccgcatctttgtgcgctccaaaatacgcagcacctttcgacgtctgaacagcaatcga
ccaaacgtggacagcctcaagtggcactatgtgcatcagatctgcgacctggcgcccacc
tatctaaccgaacagtttaatgccaccgtcgaatatttccccaatgagtcaacaacggag
ccaccccatggcaacggcagcatcgccagctcaacgcgcacctcgaccacaacgctagtc
acaggctccaatacgaccctctctaccacgataaccgggcccggtaatcagcgcaacgac
agcggcagcgacacccacacactgcgcggcagccagcagaccccacagccaagtcgtcac
agggcctcccagcagcagcagctgcagcccaactccatacccgtctatgtcaggctattt
catcatgattcacccgagcctggcctaaaggtggcgcgcgtcacatcagaagccacacta
aagtggagccttgtggccgtggtcgaagatattttctcgctgtataaggagagcgaacag
ctcgtgcgtctggaaatcgttggctttcccaaggggtatcatatgcgttttgaaacggaa
catgagatgaaatcgtttatatcctatctgggcatttatataagattgacagtaaaatgg
atgcaggacttgtgtccatcgtataagacaccatcgctggaggagttggagcgtttatat
tgtcacggacccatcggcggtggctactcatttatgaaactgcacgagaacggcgacaag
tgcggcagctatattgtacgccagtgcgatcgagagtataacacatattatattgatatc
aatacaagaattgtggccagaaacagcgatcatgatcgatgccaaactgagacattcaag
atcatacgcaaggacaaacaatggaagctggaacacaagagcgatgagcacatctttgat
cagttgtcagaactggcccagtttatacgcaccgatagccccgatcgtatacgcataccg
gcctctaaatatgataagccgccattgttgctgctctgtttgccaaaaaatttaaaaacc
aaaaagactgaagcggaattgagcgaagcggaattgcagcgtcgtaatcctcagatattt
aatgcaaaaactgacctacaatggtaccgagactcgattaatgacagcgacgatgacaag
gtgtacacaatgcgcggtgactggatgcagcagggctcgttcaaggatgtgccagtcaca
atgaaaatgctaaagtacgatgcgaattttgaagagttcatgaaactggcgcaaacctgg
agcctaatacagtcgccgcagtttattaaactgtatggcctaacattatccgtgccatat
acaatggtcatggagtactcgaaatacgggccgttaaataaatttctgcagatgcatcga
aacattagcatgtactgtttgctggacgtgatgcatggcctggtgcgtggcatgcactat
ctggaggataataagataatacacaactatatacgctgctccaatttgtacgtaaccaaa
tacgactccgagaagtatgtgctcgatgccaaaatcagcgatcccggctgtccgcgtcct
tacaagcaatccgattcaccctggataccgatcaagtactacaacaacctagagggagcc
aaacaggattctagcacacagctctgggcatttgcgactaccatttatgagattttctcg
cgcggccagctgtcgctggatcagttgaaacagcgcgatctcatacgcaatagaaccatt
gatggcggcatattgaagccgctcaaccaacgcctctgcccacctgaaatgtacaataca
attatggatggctggagcgatgatccggataagcgtttcagtcatcacgacatatttacg
cgactgaatgccatcaaaacccgcttacaacgaaactacgatgtgcctgaaacggaaatg
gagtcattcgagtactccgatgaccatatgcactgcaacgacgatgagaatgacttcagc
agcgaagcgcacgcatcttttaatggccatggcctgccaaatggccaacaccattcgccg
gactcggacagcttgactatgtgcaatggcgccgtcggcttgagcagtgaattctttgca
aattcacatgacttgccgctggtgatgcagttgtacgactgcaaggttatataccgtgag
aagcacaagattggccagggtcattatggcaccgtatataggggtgaactcgaatatcat
gataaggatcgccccaaagagcaggtggccattaagaaactgaaaaccgtgcaggtaaca
aatgattttctgcgcgaaatcgacatcatgcgcaagctggaccatcccaatgtggtcaag
ttcaagtattgggcagaaaaatcgctaagcatcatcatggagtactttgaatttggctcg
tttattgtttaccttagttcacgcaagccaagtctcaccaatgcccgcctattggccttt
gccctggacattgcccacggcatggactatttatctggcaagggtctcatacatcgcgac
ctggcagcccgcaacattctagtcgatcgttcttgtgtaaaaatctcagattttggcctg
gcccagtttgccaatgccgatggctattactatggcattagccagcgtgatataccgata
aaatggtattcgcccgaggctattgagactcttaaattctcatcgtattcggatgtctgg
agctatggcgtaacgctctttgaaatgttttcacgtggcgaaataccaaatctggtgcct
gggcaagatttaccacaggatcagtttctcaatcgcctgcgccaaggcgaacgattaccc
aagccggagctatgttcggactttgtgtacaacgagctaatgcgtccctgttggcatgaa
actcccaaatctcgaccaacttttcaacaaatcatacaaatcataacgagcgaaattggc
gacaatgttggatctgcaacgggcagtcagcagcagttgcaacaacagcagcagcagcag
cagcagcaacaacaacagcagcagcagcagcagcagcagcagttgcaacagcagcaacaa
ccactcaataggggaaactcgttagaggacatgtataagggattaacgatcacctaa

DBGET integrated database retrieval system