KEGG   Drosophila virilis: Dvir_GJ15486Help
Entry
Dvir_GJ15486      CDS       T01066                                 

Definition
GJ15486 gene product from transcript GJ15486-RA
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
dvi  Drosophila virilis
Pathway
Phagosome
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    Dvir_GJ15486
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    Dvir_GJ15486
Exosome [BR:dvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dvir_GJ15486
  Exosomal proteins of colorectal cancer cells
   Dvir_GJ15486
  Exosomal proteins of bladder cancer cells
   Dvir_GJ15486
Heparan sulfate/heparin binding proteins [BR:dvi00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  Dvir_GJ15486
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1061 aa AA seqDB search
MNWTRVLLIGLVAVLTLALVEVASLSLDPVASAELEQFIRKGDVVISTRHIRPRRKLHIS
IEALFMIDFPMLKHKMSFFLDRKQQRVTLDISANGATESRNFEIPNINETSTIRSLALQF
SKNRITLHVDCKPSTFHDIDMSLSKLYTQMDDPVIKLFRERKYPLHFDADMEHSLQRANC
QKGLHRRGNRRMLRNKISEREKNKKRDVRSNWYHEPTLARDGVDQRQQEIPTDVERGDIP
IMHGDCEDALARSLSDLLALVKLLREDVAHQRQEIAYLRMLLENCAGCKEPSGDNHIRLE
PNCRTANPCYPGVDCHETASGPRCGRCPAGFIGDGKVCKPGVSCADRPCFLGVQCHDTVN
GAQCDSCPAGYEGDGRTCSLRNPCLDTPCPSGVECIQLGFPPYFQCISCPRGHKINGTTC
HDVDECAIYQPCDERAICSNLNPGFRCGPCPPGFDGIHAHGYSADYLAVGFQKQTCLDID
ECKMGFFRCPEHAVCHNSIGSYRCQCQDGYVANGTFSCLSAADLCPDGSICARNAECVPT
DNYHYQCRCSVGWAGNGRVCGRDRDLDGWPDESLNCAEAHCRRDNCPDLPNSGQEDADLD
GMGDGCDDDADSDQVLNGKDNCPFAFNSDQLDSDHDGVGDACDNCVFISNRRQLDTDEDG
LGNECDEDMDNDSVLNQYDNCPALRNPNQSDVDNDGVGDLCDNCPTIPNPTQEDRDMDLV
GDACDSDIDGDDDGIQDSEDNCPMVSNSDQLDTDEDGKGDACDDDMDGDGVPNYRDNCPL
AKNPQQLDINHNGKGDVCEDDEDEDGTPNIIDNCPNNSMIQRTDFRTIRSVILDPEGDAQ
LDPNWEVHANGSEIIQTLNSDPGLVVGSDSFGGVDFEGTFYVNDDTDDDYVGFIFSYQSN
RKFYVVQWKKGTQTYWHSSPFRASAEPGVQIKLIDSNTGPGSMLRNSLWHAGDTPGQARL
LWKDPLNAGWKEKTSYRWSLVHRPSIGLIRLRIYEGERLILDSHNVYDATLTLKGGRLGV
FCFSQEMIIWSDLVYKCNTRVPPLIYNELPTHLKLKVELEN
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgaattggacgcgcgtgttgctaatcggcctggtggccgtcttgacgctggcacttgtg
gaggttgcatcactctcactggatccagttgcttctgctgagctggaacagtttatcagg
aaaggcgatgtggtaatttccacgcgtcacataagaccgcgacgcaaactgcatatatcc
attgaggcgctgttcatgatcgactttcccatgctgaagcataagatgtccttcttcctg
gaccgcaagcagcagcgcgttactctggacataagcgccaatggagcgacagagtcacgc
aactttgagatacccaacataaatgagacgagcaccatacgatcgttggccctgcagttc
tcgaagaatcgcattacactccatgtggactgcaagccgagcactttccacgacattgac
atgagcctgtccaagctgtatacccaaatggatgatccagtgattaagctgttcagggaa
cgcaaatatccactacactttgatgcagacatggaacactcgctgcagcgtgccaactgt
caaaagggtctccatcgccggggcaatcggcgcatgctgcggaacaagatctccgagcgt
gagaagaacaagaaacgcgatgtgcgcagcaattggtaccatgagccaactctggcacgg
gacggcgtcgatcagcgtcagcaggaaatacctacggatgtggagcgtggtgatataccc
atcatgcatggcgattgtgaagacgccctcgcacgatcgctgagcgatcttctggcattg
gttaagctgctgcgcgaagatgtcgcccaccagcgtcaggagattgcctacttgcgcatg
ctcttggagaactgtgcgggctgcaaggagcccagcggcgacaatcatatacgcctcgag
cccaattgccgcactgcgaatccttgttatcctggcgttgattgccacgagaccgcctcg
ggacccaggtgcggccgttgtcctgctggcttcattggcgatggcaaagtctgcaagccg
ggcgtcagctgcgcggacaggccctgttttctaggcgttcagtgtcacgatacggtgaac
ggtgcccagtgtgactcctgtccggctggctatgaaggtgatggacgcacatgttcgcta
cgtaatccttgcctggacacaccatgcccctcaggtgtcgagtgcattcagcttggcttc
ccgccctacttccagtgcatctcctgtccacgtggccacaaaatcaatggcaccacctgc
cacgacgtggacgagtgtgcgatctatcagccctgcgatgaacgggccatttgcagcaat
cttaatcccggctttcgctgtggaccctgcccgcccggcttcgatggcatccatgcacat
ggctattcggcggactacttggcagtgggctttcaaaagcaaacctgcttggatatagac
gagtgcaaaatgggcttctttagatgtccggaacatgctgtctgtcataatagcattggc
tcctacagatgtcagtgtcaggatggctatgtggccaatggcaccttcagctgtctatct
gcggccgatctatgtcccgatggcagcatctgcgccagaaatgcggaatgcgtgcccacg
gataattatcattaccaatgccgctgcagcgtcggctgggcgggcaatgggcgtgtctgt
ggcagggatcgcgacctggatggctggccggatgagtcgctgaactgtgctgaggcgcat
tgccgtcgcgacaactgtccagacttgccgaattctggtcaggaggatgccgatctggat
ggcatgggcgatggctgcgacgatgatgccgacagcgaccaggttttaaacggcaaggac
aactgtccgtttgccttcaatagcgatcagctggactcggatcatgatggcgtgggcgat
gcctgtgacaattgtgtctttatttcgaatcgccggcagctggacaccgacgaggatggc
ctgggcaatgagtgcgacgaggatatggacaacgattcagtgcttaatcagtatgacaat
tgtcctgcgctgcgcaatccgaatcaatccgatgtggacaacgatggcgtgggcgatttg
tgcgacaattgtccaaccataccaaatcccacgcaggaagatcgggacatggatctagtg
ggcgatgcctgcgacagcgacattgatggcgatgatgacggcatacaggactcagaggat
aattgccccatggtcagcaactcagatcaactggacacggatgaggatggcaagggcgat
gcctgtgacgatgacatggatggcgatggcgtgcccaactacagagacaactgtccactg
gccaagaatccgcaacagttagacattaatcacaatggcaagggcgatgtctgcgaggac
gacgaggacgaggacggcacgcccaacattatcgataactgtccaaacaattccatgata
caacgcaccgatttccgcactatacgttcggttatcttagatcctgagggcgatgctcag
ctggatcccaactgggaggtgcatgcaaatggttcggagattatacaaactctcaattcc
gatccgggcctggtggttggtagcgattcgtttggaggtgtcgattttgagggcactttc
tatgtcaacgatgatacggacgatgactatgtgggcttcatctttagctaccagagcaat
cgcaaattctatgtggtgcagtggaagaagggcacccagacctattggcactcgtcgccc
ttccgcgcctcggccgagccgggcgtccagataaagctaattgacagcaacacaggtccc
ggctccatgttgcgtaacagcttgtggcatgccggcgacacgcctggccaggcaaggctg
ctctggaaggatccactgaatgccggctggaaggagaagacctcatatcgctggtcccta
gtgcatcgaccttccatcgggctgatcagactgcgcatatatgagggcgaacgtttgata
ttggactcgcacaatgtttacgatgccacactcaccctcaagggcggacggctgggcgtt
ttttgtttttcccaagaaatgattatatggtcggatctggtttacaaatgcaacacacgc
gtaccgcccctcatctacaacgaactgcccacacatctcaagcttaaagtggaactggag
aactaa

DBGET integrated database retrieval system