KEGG   Drosophila virilis: Dvir_GJ15578Help
Entry
Dvir_GJ15578      CDS       T01066                                 

Definition
GJ15578 gene product from transcript GJ15578-RA
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dvir_GJ15578
Peptidases [BR:dvi01002]
 Cysteine Peptidases
  Family C86
   Dvir_GJ15578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 191 aa AA seqDB search
MPARIYHERQVAQLCALHALNNLYQRRNLFTKQQLDNYCYALTPRVWLNPHRSWLGWGNY
DINVIMYAVQQMNCETIWFDRRRDPHCLNLAEIFGFILNIGVAVRFAYYIQLPGVRSRHW
VALRRIEGNYYNLDSKLAQPRCIGNANKFLDYLRQQLRPGNDHELFIIVRRQRAEQQCWL
MPEYRLMQEGE
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgcgaatctaccacgaacggcaggtggcgcaactgtgcgcactgcacgcctta
aacaatctgtatcagcgtcgcaatctgttcaccaagcagcaactggataattactgttat
gcgctgacgccacgcgtctggctgaatccgcatcgatcgtggctgggctggggcaattac
gacatcaacgtcatcatgtacgccgtgcagcagatgaactgtgagactatttggtttgat
agacgccgtgatccgcattgcctaaatctggccgagatctttggcttcatactgaatatc
ggcgttgccgtaagatttgcctactatatacagctgcccggcgtgcgtagccggcattgg
gtcgccttgcggcgcatcgagggcaattactataatctggactcgaagctggcgcagccg
cgttgcattggcaacgcgaacaagttcttggattatctacgccagcagctgaggcccgga
aatgatcatgagcttttcataattgtgaggcggcagcgggcagagcagcagtgttggtta
atgcccgagtatcggctcatgcaggagggcgagtaa

DBGET integrated database retrieval system