KEGG   Drosophila virilis: Dvir_GJ15670Help
Entry
Dvir_GJ15670      CDS       T01066                                 

Definition
GJ15670 gene product from transcript GJ15670-RA
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
dvi  Drosophila virilis
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dvir_GJ15670
   04150 mTOR signaling pathway
    Dvir_GJ15670
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    Dvir_GJ15670
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dvir_GJ15670
Protein kinases [BR:dvi01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   Dvir_GJ15670
Mitochondrial biogenesis [BR:dvi03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    Dvir_GJ15670
  Mitophagy factors
   Other mitophagy factors
    Dvir_GJ15670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 568 aa AA seqDB search
MPQLRAAAAEAAAAGGAGAQPLVKIGHYLLGATLGTGTFGKVKIGEHQITRLKVAVKILN
RQKIKSLDVISTPSDIFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIISGVDYCHRH
MIVHRDLKPENLLLDHNMHVKIADFGLSNMMLDGEFLRTSCGSPNYAAPEVISGKLYAGP
EVDIWSCGVILYALLCGTLPFDDEHVPSLFRKIKSGIFPIPEYLNKQVVNLVCQMLQVDP
LKRATIEEIKKHEWFQKDLPAYLFPSSIEQDSNVIDTYAVAEVCTKFGVKESEVHNSLLS
GDPHDQLAIAYHLIIDNKRFADDAATQISEINNFFVAGSPPPPMSHSPHEPRSSGAEPSA
TVVAGAGASGAGGGGVGGASGGTAASSGSATPSGAASSAAPSIRPHPERIAPMRERQLAM
SVQNTGGAAFPEKTARGGTPIKRAKWHLGIRSQSKPNDIMLEVYRAMKALNYEWKIINPY
HVRVRRQNVKTGKFSKMSLQLYQVDPKSYLLDFKSLTNDEVEQGDDVIMESLTPPPLSVS
GAMPQQPTGHHTMEFFEMCAALIIQLAR
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgccacagttgagagccgctgccgctgaggcggccgctgctggcggcgccggcgcccag
ccgctggtcaagattggccactatctgctcggcgcaacgctgggcaccggcacctttggc
aaggtgaagatcggcgagcatcagatcacacgtctgaaggtcgccgtcaagatactcaat
cgccagaagatcaagagtctggatgtcatctcgacgccctcggacatattcatgataatg
gagtatgtgagcggcggggagctgttcgattatattgtgaagcatggcaagctgcaggag
catcaggcgcgacgcttctttcagcagatcatatcgggcgtagactattgccacaggcat
atgattgtccatcgggacctgaagccggagaatctgctgctcgatcacaatatgcacgtg
aagatcgccgactttgggctgtcgaacatgatgctcgacggtgaattcttgcgcacatcg
tgcggctcacccaactatgcggcgcccgaggtgatatccggcaaattgtatgccggaccc
gaggtggacatctggtcatgcggcgtcatactgtatgccctgctctgcggcacgctgccg
ttcgatgatgagcatgtgccttcgctgtttcgcaaaatcaaatcgggcatatttcccata
ccggagtatctaaacaagcaggtggtgaatttggtgtgccagatgctgcaggtggatccg
ctgaagcgtgccaccattgaggagatcaagaagcacgagtggttccagaaggatttgccc
gcctatttgtttccctcctcgatcgagcaggactccaatgtcatcgatacgtacgccgtg
gccgaggtgtgcaccaagttcggcgtcaaggagtccgaggtgcacaattcgctgctcagc
ggcgatccgcacgatcagctggccattgcctatcatctgatcattgacaacaaacgcttc
gcagacgatgcggccacacagatcagcgagatcaacaactttttcgtggccggctcaccg
ccgccacccatgtcccattcgccgcacgagccccgctccagcggcgccgagccctccgcc
acggttgttgccggcgcaggtgcttctggcgccggcggcggcggcgtgggcggcgctagc
ggaggcactgcagccagttcgggcagcgccacgcctagcggcgcggcgagcagcgctgcg
cccagcatacgaccgcatccggagcgcatagcgccgatgcgcgaacgacagctggccatg
tccgtgcagaatacgggtggagccgcctttcccgagaagacggcgcgcggcggcacgccc
atcaagcgggccaaatggcatctgggcatacgatcgcagagcaaaccgaacgacatcatg
ctggaggtatatcgggccatgaaggcgctcaactacgaatggaagatcatcaatccgtat
catgtgcgcgtccggcgtcagaatgtcaagaccggcaaattctcgaaaatgtcgctgcag
ctgtatcaggtcgatccgaagagctatctgcttgacttcaaatcgctgaccaatgacgag
gtcgagcagggcgacgatgtcatcatggagagcctcacaccgcctccattgagcgtcagc
ggcgccatgccccagcagccgacgggccatcatacgatggagttctttgagatgtgcgcg
gcgctcatcatacagctggcgcgctaa

DBGET integrated database retrieval system