KEGG   Drosophila virilis: Dvir_GJ15681Help
Entry
Dvir_GJ15681      CDS       T01066                                 

Definition
GJ15681 gene product from transcript GJ15681-RA
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
dvi  Drosophila virilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 625 aa AA seqDB search
MYRLEDTNSGAVMDKNKQKLSAGYGSSGGAVDTSQGSGSGGGGGGRQRHAPLYGRFVVEE
ELPATHRDVMHHHSSPSSSSEVRAMQARIPTHFRDPAMAPLRKLSVDLIKTYKHINEVYY
AKKKRRAQQTQGDDDSSNKKERKLYNDGYDDDNHDYIIKNGEKFLDRYEIDSLIGKGSFG
QVVKAYDHEEQCHVAIKIIKNKKPFLNQAQIEVKLLEMMNRADAENKYYIVKLKRHFMWR
NHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPE
NILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGIQYDLAIDMWSLGCIL
VEMHTGEPLFSGCNEVDQMNKIVEVLAIRPKILVNKPTKRAKFSERISTNGSQGLKRTVK
GRKSKRPGSPKRHDILGVETGGPAGRRMDEPGHSVSDYLKFKDLILRMLDFDPKTRVTPY
YALQHNFFKRTTDESTNTSGAGATANAGAGGNSGSGGSSGAGGGGTGGPGGGAAATGGPG
ATNNSNSIVSSSVAAAAGVVNNSSSSGGSSSNSGIAGGATGQQQQQQQSLVSSSNSGAID
PQCLGKSQSAPLLPTSISLYHTLAL
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgtatagattggaggacacgaacagcggcgccgttatggataagaacaagcagaaatta
tccgctggctatggttccagtggtggcgccgtggacacatcgcagggcagcgggagcggc
ggcggcggcggcggcagacagcgccatgcgccgctctacggacgctttgtggtcgaagag
gaactgcccgccacgcatcgtgatgttatgcatcatcactctagtccttcgtcttcgtcg
gaggtgcgcgccatgcaggcacgcatacccacacactttcgagatccggccatggcacca
ttgcgcaagctgagcgtcgatctgataaagacctacaagcacatcaatgaggtatactac
gcgaagaaaaagcgccgagcccagcagacacagggtgatgatgattcgtcaaataaaaag
gagcgcaagttgtataatgatggttacgatgatgataatcacgactatatcatcaaaaat
ggcgagaagtttctggatcgttacgagattgattcactaatcggcaaaggcagttttggt
caggtggtcaaggcctacgatcatgaggagcaatgccatgtggcaatcaagataattaag
aataagaaaccgttcctaaatcaggcacaaatcgaagtcaagctgctcgagatgatgaat
cgtgcggatgctgaaaacaaatactatatcgtcaagctcaagcgccattttatgtggcgc
aatcatctgtgcctcgtcttcgagctgctctcgtataacctgtacgatctgcttaggaac
acaaatttccgtggcgtctcgctgaacctcacgcgcaaatttgcgcagcaactgtgcacg
gcccttctgttcctgagcacacccgaactgaacataatacactgtgatctgaagcccgag
aacatattgctatgcaatcccaagcgatcggccatcaaaattgttgatttcggcagctcc
tgtcagctgggacagcgcatctatcagtacatccaatcgcgcttctatcgctcgccggag
gtgctgctgggcatccaatatgatctggcgatcgatatgtggtcgctgggctgcatactg
gtcgagatgcacaccggagagccgctcttctccggctgcaacgaggtcgatcagatgaac
aagattgtcgaggtgctggccatccgccccaagattttggtgaacaagcccaccaaaagg
gcaaagttttcggaaaggatctcaaccaacggttcccaggggctaaagaggaccgtaaag
ggtcgcaaatccaagcggccgggttcccccaagcggcacgatatattgggcgtcgaaacg
ggcggaccggccggcaggcgcatggacgagcccggccattcggtgtccgactatctcaag
ttcaaggatctgatactgcgcatgctcgactttgatcccaagacgcgcgtcacaccgtac
tatgccttgcagcacaatttcttcaagcgcaccaccgacgagtcgaccaacacgagcggc
gcgggcgccactgcgaatgccggcgccggcggcaacagcggctccggcggctcctccggc
gccggcggtggtggaactggcggaccaggcggtggtgcggcagcaaccggcggacccggc
gccaccaacaacagcaacagcattgtctcctccagcgtcgcagccgcagctggcgtcgtc
aacaactcctcatcttccggcggcagcagcagcaacagcggcatcgccggcggcgccacc
ggacagcagcagcagcagcaacagtcgctcgtctccagcagcaacagcggcgccatcgat
ccccaatgtttaggtaagtcacaatccgcacctcttcttcccacctccatctcgctttat
cacactcttgctttgtag

DBGET integrated database retrieval system