KEGG   Drosophila virilis: Dvir_GJ15706Help
Entry
Dvir_GJ15706      CDS       T01066                                 

Definition
GJ15706 gene product from transcript GJ15706-RA
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.1.2.15]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dvir_GJ15706
Peptidases [BR:dvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dvir_GJ15706
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 344 aa AA seqDB search
MRNRPTLRFWCAKRTLRYQARPXXFSYQSAMEFMEPQTQPLPASPILGGERLSRPRQTQA
QTQQLQLQQQQENHSERLNRRVSSSCRSLERLNRGPGRVSIWSSMMPSQVAHPFQGAMGA
QIVCNGCGSKSAVRYDKFDSVTLNLPAQRRSGLSLGHLLSEYITSEDLSDVKCDSCNETT
MHTKSVTFAKLPACLCIHIARTVWLPTGQVCKRQDYVHFPESLSMAPYSFVQPHLNSQAG
TPWGSTMSLYSTSLPMNNGGGAGGEGFGAMFPKNLYRLLAVVVHSGEANSGHFVTYRRGS
LRNAHRWFYTSDTIVREVSIDEVLSVPAYLLFYDRGQQRQLQMR
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaggaatcgcccaactctgcgtttttggtgcgcaaagcgaaccctccgatatcaggcc
cgaccnnnnnngtttagctatcaatcggccatggagtttatggagccgcaaacgcagccc
ctgcccgcttcacccatactgggcggcgagcgcttgtcgcgtccgcgccaaacccaggcc
cagacccagcagctgcagctgcagcagcagcaggagaatcacagcgaacgcctcaatcga
cgcgtgtccagctcgtgccgctcgctggagcgtctcaatcgcggacccggacgcgtctcc
atctggtcaagcatgatgcccagccaggtggcgcatccgtttcaaggcgccatgggcgca
caaattgtctgcaatggctgcggctccaagtccgccgtgcgctacgacaaattcgatagc
gtcaccttaaatttgccggcacaacggcgctccggcctgagcctgggccatttgctgagc
gagtatatcacctccgaggatctgagcgatgtcaagtgcgattcatgcaatgagacaacc
atgcacaccaaatccgtgacctttgccaagctgccggcctgtctctgcatacacattgcg
cgcaccgtttggctgcccaccgggcaggtgtgcaagcgtcaggactatgtccactttccg
gagagcctctccatggcgccatacagctttgtccagccccatctgaacagtcaggcgggc
actccttggggctcgaccatgtcgctgtactccaccagcctgccgatgaacaacggcggc
ggcgccggcggcgagggattcggtgcgatgtttcccaaaaacctctaccgcctgctggcg
gttgtggtgcattcgggtgaggcaaacagtggacattttgttacctatcgacgtggttcg
ctgcgcaatgcgcatcgatggttttacacgtcggacacgattgtgcgggaggtgtccatt
gatgaggtgctcagcgtgcccgcctatctactcttctatgatcgcggccagcagcgacag
ctccaaatgcgctga

DBGET integrated database retrieval system