KEGG   Drosophila virilis: Dvir_GJ15723Help
Entry
Dvir_GJ15723      CDS       T01066                                 

Definition
GJ15723 gene product from transcript GJ15723-RA
Orthology
K17610  
calcineurin B homologous protein 1
Organism
dvi  Drosophila virilis
Brite
Protein phosphatases and associated proteins [BR:dvi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Dvir_GJ15723
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 228 aa AA seqDB search
MGLTASHQLNASELSAYQAATGLSTEQLEQLHTRFQALDRRQRGYLTPTELLRIPQLAQN
PLHRQIIDGFFAVIKETDSDANKDKAAAADTDADATSADRIYFGQFVRTCATFMVPQFGQ
LTHTRADGRAQKLRLLSQMFDTQRSGRIERADFRRTMKCLLDSVPPSDGVANLHPQGSET
ELQQLEDLAFGASDSISYEQFEQRLATADVEGGLAVRKWLEEPADETN
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgggcctcacggccagccatcagctgaacgcatcggagctgagcgcatatcaggcggcc
accgggctgtccacggagcagctggagcagttgcatacacgcttccaggcgttggatcga
cgtcagcgcggctatttgacgccaaccgagctgctgcgcataccgcagttggcgcagaat
ccactccaccgccagatcatcgatggcttctttgccgtcatcaaggaaaccgactcggat
gcgaacaaggacaaggctgcggctgcggatacggatgcggatgctaccagtgccgatcgc
atctattttggccaatttgtgcgcacctgcgccacctttatggtgccccaatttggtcag
ctgacacatacgcgcgccgatggccgcgcccagaagctgcgcctgctctcccaaatgttc
gacacgcagcgcagcggacggatcgaacgcgccgactttcggcggacgatgaaatgcctg
ctggacagcgtcccgccctcggatggggtggccaatctgcatccgcagggcagtgaaacg
gagctccagcagctggaggaccttgcctttggcgccagcgatagcatctcctacgagcaa
ttcgaacagcgtctggccacggccgatgtcgagggcgggctggcggtgcgcaagtggctg
gaggagcccgccgacgagaccaactga

DBGET integrated database retrieval system