KEGG   Drosophila virilis: Dvir_GJ15750Help
Entry
Dvir_GJ15750      CDS       T01066                                 

Definition
GJ15750 gene product from transcript GJ15750-RA
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
dvi  Drosophila virilis
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:dvi03013]
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:dvi03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 189 aa AA seqDB search
MDSNPTELGAKPRTNNKNNQQRRNQSQRIVRKLPPRAASDRRNIYITSKTDFKAQQKRCE
DLLNAGAKEIYLHCMGYSITRGLNLALRLIQNSDGALSYAINTSTIQLLDELHPLCDDDD
ITYRKRNNSALHIKIYNSSLFDIVVPKLPAQPTLSGIGHNEANTKPTQTQRKTQQQQQQQ
QQHKKPKHK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggacagcaatccaacggaactcggggcaaagccaagaaccaacaacaaaaacaatcag
cagcgccgcaaccaaagccaacgcattgtacgcaagctgccgccgcgtgctgccagcgac
agacgaaatatttatattaccagcaagacggactttaaggcacagcagaagcgatgcgag
gatctgctcaacgcgggtgctaaggaaatctatttgcattgcatgggctattcgattaca
cgtggcctcaatttggcattgcgtctcatccagaactcggacggagcgcttagctacgcg
ataaacacatccaccatacagctgctggatgagctgcatccactgtgtgatgacgacgat
ataacctatcgcaagcgcaacaattccgcgctacacatcaaaatctacaacagcagcctc
ttcgacattgtcgtgcccaagctgccggcacagccgacgctgtccgggatcggtcacaac
gaagccaacacaaagccaacgcaaacacagcgcaaaacccagcagcagcagcagcaacaa
caacaacataagaaaccgaaacataagtaa

DBGET integrated database retrieval system