KEGG   Drosophila virilis: Dvir_GJ15750Help
Entry
Dvir_GJ15750      CDS       T01066                                 

Definition
GJ15750 gene product from transcript GJ15750-RA
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
dvi  Drosophila virilis
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dvir_GJ15750
   03008 Ribosome biogenesis in eukaryotes
    Dvir_GJ15750
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     Dvir_GJ15750
Ribosome biogenesis [BR:dvi03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     Dvir_GJ15750
Transfer RNA biogenesis [BR:dvi03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    Dvir_GJ15750
Mitochondrial biogenesis [BR:dvi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    Dvir_GJ15750
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 189 aa AA seqDB search
MDSNPTELGAKPRTNNKNNQQRRNQSQRIVRKLPPRAASDRRNIYITSKTDFKAQQKRCE
DLLNAGAKEIYLHCMGYSITRGLNLALRLIQNSDGALSYAINTSTIQLLDELHPLCDDDD
ITYRKRNNSALHIKIYNSSLFDIVVPKLPAQPTLSGIGHNEANTKPTQTQRKTQQQQQQQ
QQHKKPKHK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggacagcaatccaacggaactcggggcaaagccaagaaccaacaacaaaaacaatcag
cagcgccgcaaccaaagccaacgcattgtacgcaagctgccgccgcgtgctgccagcgac
agacgaaatatttatattaccagcaagacggactttaaggcacagcagaagcgatgcgag
gatctgctcaacgcgggtgctaaggaaatctatttgcattgcatgggctattcgattaca
cgtggcctcaatttggcattgcgtctcatccagaactcggacggagcgcttagctacgcg
ataaacacatccaccatacagctgctggatgagctgcatccactgtgtgatgacgacgat
ataacctatcgcaagcgcaacaattccgcgctacacatcaaaatctacaacagcagcctc
ttcgacattgtcgtgcccaagctgccggcacagccgacgctgtccgggatcggtcacaac
gaagccaacacaaagccaacgcaaacacagcgcaaaacccagcagcagcagcagcaacaa
caacaacataagaaaccgaaacataagtaa

DBGET integrated database retrieval system