KEGG   Drosophila virilis: Dvir_GJ16056Help
Entry
Dvir_GJ16056      CDS       T01066                                 

Definition
GJ16056 gene product from transcript GJ16056-RA
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dvi  Drosophila virilis
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dvi00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 577 aa AA seqDB search
MTEGKNVPNSSADVPFRSKELRKQSLIQHTGLVGVIDEGTKTIGFSIYTTPDFKEIAAHR
VELSVITLQDGWYEQDPMEMMASINKCAEEAIKQLPELGFSASDIATVGITNQRETTIVW
DAVTGKPLYNAIVWKDIRTSSTVEQIVAKVQDVNHFKRSTGLPISTYFSALKIRWLKDNV
PEVRQACREKRCKAGTVDSWIVWNLTNGALHITDVTNASRTLLMNLETLHWDPVLLKTFA
IREEMLPSIRSCSEVFGKITSDRSALRGLTLSGILGNQQASLLGQMCVKPGQTKNTYRSG
CFLLCNTGDKPVFSRHGLLTTIAYKLGPQAPTIYALEGSVSVAGHALSWLQQKVRLLPDS
RDAEKYAEAVPTSGDVYFVPAFTGLYAPYWRQNARGIIIGLTQFTRKNHIVRAALESICF
QTRDILECMHQECGYEINKLHADGKLITNNLLMQLQADTAGLPLFRSQLMDSTAFGAAMC
AAQAEGINLCKFEPEKRYYENVHYDTFLPTTTEHERAERYGKWKRAVERSLGWVIKQKKT
RTHTEENYRMLSSLPASIFLISSFAMLVHSLSATVKS
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaggcaagaacgtacccaattccagtgccgatgtcccgtttcgcagtaaggag
ctgcgcaagcagtcgcttatccagcacacgggattggtgggtgtcatcgatgagggtact
aagacgattggcttctcgatttatacgacgcccgatttcaaggaaatcgcggcacatcgc
gtggaacttagcgtgataacgctacaggatggctggtacgagcaggatcccatggaaatg
atggcctccattaacaaatgcgccgaggaggccatcaaacagctgccggagctgggattt
agtgcgtcagacatagccaccgtgggcattaccaatcagcgggagacgaccatcgtctgg
gatgcggtgacgggcaagcccctctacaatgccatcgtttggaaggatatacgcaccagc
agtaccgtggaacaaattgtggccaaggtgcaggacgtgaatcactttaaacggagcacg
ggtctgcccatatccacgtacttctcagccctgaaaattcgctggctcaaggacaacgtg
cccgaggtgcggcaggcgtgtcgcgagaaacgctgcaaggccggcaccgtagacagctgg
atcgtctggaatctgaccaatggtgcactgcacatcacagacgtgacaaatgcgtcgcgc
actctgctgatgaacttggagacgctgcactgggatccggtgctattgaaaaccttcgcc
atccgagaggagatgctgcccagcatacgcagctgctcggaggtcttcggcaagatcacc
tccgaccgcagcgcgttgcgcggacttactctgagcggtatcctgggcaatcagcaggcc
tcgcttctgggccagatgtgcgtgaagccgggccagacgaagaatacgtatcgttccggc
tgctttctgctgtgcaatacgggcgacaagcccgtcttctcgcgtcacggtctgctcacc
acgatagcctacaagctgggcccccaagcgcccaccatctatgcgctggagggctccgtc
tcggtggccggacatgcgctctcctggctgcagcagaaggtgcgcctactgccggactcg
cgggacgccgagaaatacgccgaggcagtgcccacatcgggcgatgtctacttcgtgccg
gcctttacgggtctctatgccccatactggcgacagaatgcccgcggcatcatcatcggc
ctgacacagttcacgcgcaagaatcacattgtgcgcgccgctctggagagcatctgcttc
cagacgcgcgacatactggagtgcatgcatcaggagtgcggctatgagatcaacaagctg
catgccgacggcaagctgatcacgaacaatctgctgatgcagctgcaggcggacaccgcg
gggctgccgctgttccgctcccagctgatggactcgacggccttcggtgcggccatgtgc
gcagcccaggcggagggcatcaatctgtgcaaattcgagccggagaagcgatactacgag
aacgtacactacgacacatttttgcccaccacaacggagcacgagcgcgccgaacgctat
ggcaaatggaagcgcgccgtcgagcgcagcctgggctgggtcatcaagcagaagaagacg
cgcacccacaccgaggaaaactacaggatgttgtcctcactgccggcgagcatctttctc
atcagcagctttgccatgctggtgcattccttatcggcgacggtcaagtcataa

DBGET integrated database retrieval system