KEGG   Drosophila virilis: Dvir_GJ16425Help
Entry
Dvir_GJ16425      CDS       T01066                                 

Definition
(RefSeq) GJ16425 gene product from transcript GJ16425-RB
  KO
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dvir_GJ16425
Chromosome [BR:dvi03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Dvir_GJ16425
   HAT complexes
    TIP60 complex
     Dvir_GJ16425
    NuA4 complex
     Dvir_GJ16425
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 548 aa AA seqDB search
MKNKYEFDDDVASICESTAALTEGCRLSVRMHKTDDWPLAEIVSIKEQDGRRQFYVHYVD
FNKRLDEWVNEDDLDTRKVQFPRRDGPQTGTSTGVTTPKRHHSLAGSVSRPTSPQPQHAG
LGGVGGGVVGGIGTGIPLTGSVGSMGGVGGGSELVNGNNVLAAALQKRINRRRKVHGNSG
HSHTSAAQLQQQQSQQLQQTLQTSQTPLHVTGDGGLLPTTPGSVGGGGITSAGNEDGSQD
GKMATPRQSGSMVTHQDDVVTRMKNVEMIELGRHRIKPWYFSPYPQELCQENCIYICEFC
LKYCKSRKCLERHLSKCNLRHPPGNEIYRKNTISFFEIDGRKNKVYAQNLCLLAKLFLDH
KTLYYDTDPFLFYIMTEFDSRGFHIVGYFSKEKESTEDYNVACILTMPPYQRKGYGKLLI
EFSYELSKFEGKTGSPEKPLSDLGLLSYRSYWAQTILEILISQNTSTDGEKPTITINDIC
ECTSIKKEDVISTLQNLNLINYYKGQYIVCIGRETIEQHQRAMMKRKIRIDSKCLHWTPK
DWSKRSKW
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacaaatatgaattcgacgatgatgttgcatcaatctgtgaatcgacggctgca
ttaaccgagggctgccgcctatctgtgcgcatgcacaagaccgacgactggccgctggcc
gagatagtcagcatcaaggagcaggacggcaggcgccagttctatgtgcactatgtcgat
tttaataagcgcctggacgagtgggtcaacgaggatgatttggacacgcgcaaggtgcag
tttccgcgccgcgacggaccacagactggcaccagcacgggcgtcacaacgcccaagcgt
catcattcacttgcgggcagtgtctcgcgcccgacatcgccgcagccgcaacacgctggc
ctcggcggcgttggcggtggcgttgttggtggcattggcactggcataccactaactggt
tctgtcggctcaatgggcggcgtcggcggcggcagcgaactcgtcaatggcaacaatgtg
ctggcggcggctttacagaagcgcatcaatcgtcggcgcaaagtgcacggtaactccggc
catagccacacatcagcagcgcaactacaacaacaacagtcgcagcagctgcaacagaca
ttacagacatcccagacgccgttgcatgtgaccggcgatgggggtctgttgccaacgaca
cccggcagcgtcggcggaggaggaataacatctgcaggcaacgaggatggctcgcaggat
ggcaaaatggcgacacccaggcaatcgggcagcatggttacacatcaggatgatgtggtg
acgcgcatgaaaaatgttgaaatgatcgaattgggtcgtcatcgcattaagccctggtac
ttctcaccatatccgcaggagctgtgccaagagaattgcatttacatatgcgaattttgt
ctaaagtattgcaagagtcgcaaatgcctggagcgtcacttgtccaaatgtaatctacgc
catccgcccggcaatgagatctatcgcaagaacacaatttccttctttgagatcgatgga
cgcaagaacaaggtgtatgcacagaatctctgcctgctggccaaactgtttttggaccac
aagaccctctactatgacacggatccgtttttgttctacatcatgaccgagtttgattca
cgcggctttcacattgttggctacttttccaaagagaaggagagcaccgaggattataat
gtcgcttgcattttgactatgccgccatatcagcgcaagggctatggcaagctcttaatt
gagtttagctacgagctgtccaaatttgagggtaaaaccggttcgccagagaagccactc
tcggatttgggcctgctctcctatcgctcctactgggcacagaccatactcgagattttg
attagccagaacaccagcacggacggcgagaagcccaccattaccatcaacgacatctgc
gagtgcacttccattaagaaggaggatgtgatctccacattgcagaatcttaatctgatc
aattactacaagggccagtatattgtctgcatcggacgggagaccattgagcagcatcag
cgcgccatgatgaagcgcaagatacgcatcgattccaagtgcctgcactggacacccaag
gactggtcgaagcgctccaagtggtaa

DBGET integrated database retrieval system