KEGG   Drosophila virilis: Dvir_GJ16483Help
Entry
Dvir_GJ16483      CDS       T01066                                 

Definition
GJ16483 gene product from transcript GJ16483-RA
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
dvi  Drosophila virilis
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:dvi00562]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:dvi00920]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:dvi04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 348 aa AA seqDB search
MNGRTIRINRVPATITAILLTIVLVYFLNFHKDERPAIYGMLRSDNKVNLRKMLIAAIQA
AQRGGLEVLDVAHTRQLKERSKGKTAEGVNDPFTDADGRSHCVMKQGLQRIFPRVRIFSE
EDKEHCKDAHSFDLDPTVLHETASVPDVAVTAQDVTIWVDPLDATKEFTEELYEYVTTMV
CVAVAGRPVIGVIHNPFSGQTAWAWVGHSMSEYLDELHKQPRLNSEQPIITVSRSHAAAV
KEVARNVFGENVSLLTAAGAGYKVLQVVANNATAYLHTSIIKKWDICAGEAILRALGGAM
STLDDEPINYGPHDSPVNSGGLLASLDQHEEYMERFAKYRSTHNGKLR
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaacggacgcaccatacgcatcaatcgggtgccagctaccataaccgccattctgctg
accattgtgcttgtttactttctcaactttcacaaggatgagcggccggccatctatggc
atgctacgcagcgataataaagtgaatctgcgcaaaatgctaattgccgccatacaggcg
gcacagcgcggcgggttggaggtgttggatgtggcgcatacgcgccagctaaaggagcgc
agcaagggcaaaacggctgaaggtgtcaacgatccgtttacggacgcggatggccgctcg
cattgtgtgatgaagcagggtttgcagcgcatttttccgcgtgttcgcatcttctccgag
gaggacaaggagcattgcaaggatgcgcacagtttcgatctggatcccactgtgctccac
gagacagccagcgtgcccgacgtggcagtaaccgcgcaagatgtaaccatttgggtggat
ccgctcgatgccaccaaagagtttacagaggagctgtacgagtatgttacgaccatggtg
tgcgtcgctgtcgccggccgtccagtgatcggcgtcatacacaatccgttcagcggccag
acagcttgggcgtgggtgggccacagcatgtccgagtatctggatgagctgcacaagcag
ccgcgcctcaactccgaacagcccatcatcaccgtatcgcgatcgcatgccgccgccgtc
aaggaggtggcgcgcaatgtgtttggcgagaatgtcagcttgctgacagccgccggtgcc
ggttacaaggtgctgcaagttgtggccaacaatgcgaccgcctatctgcacacttccatc
atcaagaagtgggacatatgcgccggcgaggccatactgcgcgcccttggcggcgccatg
tccacgctcgacgatgagcccatcaactatggcccccacgactcgccagtgaatagcggc
ggccttttggccagcctggaccagcatgaggagtacatggaacgcttcgccaaatatcgt
tcaacgcacaatggcaagctcaggtag

DBGET integrated database retrieval system