KEGG   Drosophila virilis: Dvir_GJ16530Help
Entry
Dvir_GJ16530      CDS       T01066                                 

Definition
GJ16530 gene product from transcript GJ16530-RA
Orthology
K04432  
mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
dvi  Drosophila virilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 335 aa AA seqDB search
MSRPRPRLTPIGISREPEPAFVPPRNLDSRATIQIGEQTFDIDADSLEKICDLGRGAYGI
VEKMRHRQTGTVLAVKRIPMTVNFREQQRLIMDLDISMRSSDCPYTVHFYGAMYREGDVW
ICMEVMNTSLDKFYPKVFKNQLTMEEPVLGKIAMSVVSALHYLHAQLKVIHRDVKPSNIL
INRGGQVKICDFGISGYLVDSVAKTIDAGCKPYMAPERIDPQGNPAQYDIRSDVWSLGIS
MIEMATGQYPYNKWRTPFEQLRQVVEDDPPRLPAGSFSAEFEDFIATCLKKEYTARPNYE
QLLRHGFIVEHLQRNTDISEFVARILDLPDEQPSQ
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgaccacgtccgcgcctcacacccattggcatttcgcgtgagccggaaccggca
ttcgtgccgccgcgtaacctggactcacgggcaaccatacaaattggcgaacaaacattt
gacatcgatgccgacagcctggagaagatctgcgatttgggacgcggcgcctacggcatt
gtggagaagatgcggcatcgccagacgggcacagtgctcgccgtcaagcgcatcccaatg
actgttaatttccgggaacagcaacgcctgattatggatctggacatatcgatgcgttcc
agcgattgcccctatacggtccatttctatggcgccatgtatcgcgagggcgatgtctgg
atatgcatggaggtgatgaacaccagcctggacaaattctatccgaaggttttcaaaaat
cagctaaccatggaggagccggtgctcggcaaaattgcgatgagcgtggtcagtgcgttg
cattatctgcacgcccagctgaaggtcatacatcgtgatgtaaagccatcaaatatactg
atcaatcgtggtggtcaggtgaaaatatgcgattttggcatctcaggctatctagttgat
tccgtggccaagaccatagatgccggctgcaagccttatatggcgccggaacgaatcgat
ccgcaaggtaacccagcccaatatgatatacgctccgatgtctggtcgctgggcatcagc
atgattgaaatggccaccggccagtatccctataataaatggcgaacgcccttcgagcag
ctgcgtcaggtggttgaggatgatccgcccaggctgccggcgggctcattctccgccgag
ttcgaggacttcatagcgacatgcctgaagaaggagtacacggcgcgacccaactacgag
cagctgctgcggcacggattcattgtggagcatttacagcgcaatacggacatctccgag
tttgttgccaggatattggatctgcccgatgagcagccatcgcagtag

DBGET integrated database retrieval system