KEGG   Drosophila virilis: Dvir_GJ16530Help
Entry
Dvir_GJ16530      CDS       T01066                                 

Definition
(RefSeq) GJ16530 gene product from transcript GJ16530-RA (EC:2.7.11.-)
  KO
K04432  
mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
dvi  Drosophila virilis
Pathway
MAPK signaling pathway - fly
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dvir_GJ16530
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dvir_GJ16530
Protein kinases [BR:dvi01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Dvir_GJ16530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 335 aa AA seqDB search
MSRPRPRLTPIGISREPEPAFVPPRNLDSRATIQIGEQTFDIDADSLEKICDLGRGAYGI
VEKMRHRQTGTVLAVKRIPMTVNFREQQRLIMDLDISMRSSDCPYTVHFYGAMYREGDVW
ICMEVMNTSLDKFYPKVFKNQLTMEEPVLGKIAMSVVSALHYLHAQLKVIHRDVKPSNIL
INRGGQVKICDFGISGYLVDSVAKTIDAGCKPYMAPERIDPQGNPAQYDIRSDVWSLGIS
MIEMATGQYPYNKWRTPFEQLRQVVEDDPPRLPAGSFSAEFEDFIATCLKKEYTARPNYE
QLLRHGFIVEHLQRNTDISEFVARILDLPDEQPSQ
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgaccacgtccgcgcctcacacccattggcatttcgcgtgagccggaaccggca
ttcgtgccgccgcgtaacctggactcacgggcaaccatacaaattggcgaacaaacattt
gacatcgatgccgacagcctggagaagatctgcgatttgggacgcggcgcctacggcatt
gtggagaagatgcggcatcgccagacgggcacagtgctcgccgtcaagcgcatcccaatg
actgttaatttccgggaacagcaacgcctgattatggatctggacatatcgatgcgttcc
agcgattgcccctatacggtccatttctatggcgccatgtatcgcgagggcgatgtctgg
atatgcatggaggtgatgaacaccagcctggacaaattctatccgaaggttttcaaaaat
cagctaaccatggaggagccggtgctcggcaaaattgcgatgagcgtggtcagtgcgttg
cattatctgcacgcccagctgaaggtcatacatcgtgatgtaaagccatcaaatatactg
atcaatcgtggtggtcaggtgaaaatatgcgattttggcatctcaggctatctagttgat
tccgtggccaagaccatagatgccggctgcaagccttatatggcgccggaacgaatcgat
ccgcaaggtaacccagcccaatatgatatacgctccgatgtctggtcgctgggcatcagc
atgattgaaatggccaccggccagtatccctataataaatggcgaacgcccttcgagcag
ctgcgtcaggtggttgaggatgatccgcccaggctgccggcgggctcattctccgccgag
ttcgaggacttcatagcgacatgcctgaagaaggagtacacggcgcgacccaactacgag
cagctgctgcggcacggattcattgtggagcatttacagcgcaatacggacatctccgag
tttgttgccaggatattggatctgcccgatgagcagccatcgcagtag

DBGET integrated database retrieval system