KEGG   Drosophila virilis: Dvir_GJ16535Help
Entry
Dvir_GJ16535      CDS       T01066                                 

Definition
GJ16535 gene product from transcript GJ16535-RA
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
dvi  Drosophila virilis
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dvir_GJ16535
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2049 aa AA seqDB search
MDGGVLEDMWTPYKRLYDICQLAIRNPNEVTADFELCLKKYKQNFTNFLRNPPKSEKSRS
HLRNALLEGVMLAGQSRKVELSQEIIDEAIILSDMFDLDEIFALELLCTAQRQQVHHPGL
PRGLVAVLLYYDGRKAITCTLRDMFQAVSGVSWSTELPREMTALINNYCQNLVEDSNILG
RLLELLAEMDMEREISLLTKNRAFGSKKHQNQVLALYEDTRKALAMALFHWSAQRGLPKN
IAIRLLQHLANTKSTDAAGNMDDVTLIMLMALLYAYDTSVLLITECDSPHTARLPILSDP
DYAKCFYEAIYAQSSWQTQHLDAIIKYSFGLTLASLRQAPSELQANAGALINRDEQLIDE
ALAANVFTFFYRQLLEKNVVYTTEFIYRRLHLLITDFIDFMHAKVSELRGRADETARTVI
SFQNEGLEPPPNLDVNFELLMLCVAKLYGDKRATITLCNEYWGPTDTTTANGVANYVQNT
SRAVSLFKFIRLASELLPQTLFRSYLKMIAGLTRTEFAARCAFNLLKNSQNLSSTYAVSW
DHFFNALNNYFNNMRTDFDSMANAGDSIYRSTGIPRNMTPRETEHMAAVMGIMQAVAEND
EISRIMLCEQANWQTPQVLLGLVACSTPVMLKGEILFTLAALSRSKETARTIWFHLEESQ
IIPTVTMVSSAHAEFSLAEEIDQNESRLETYKLTRGILQLLYTLMTTHMPRSLGCGPRKP
GYDPYLKFVVESILLKFYNRAYKDPTEKWAVGTKCLKLLYFLLASYRPKASDFVEQRDEH
AYPGYHIMLQLQVKSDMLRLVLRIIEEARERLDDYNQFNGKELLEECALYALLLLEVALA
KQNAFFEAHATANCSILLLGLNRMLLDLNPRSRSPDYVLNIVKFVTFNSWLPRHALASIK
ILSAVSMLPDVVSQILNMYAHGSTEKLEIRQRFVECLEMDMRRGSPLNDDELTDQFIGID
QFGYPLDGNLNETDLHVDLEALGFRKPQRIELQIKEAIVELFEVNLSQPMPNFVYFLLGI
DVIRDILGNEKQQLGLDVNCSCINSLVLLLERYLEQQRHSDDYCEHTAHIVERIYHLFHG
LCAHRRTSEAILRYFRLTCNDFLLRHLTAMPFRHFGEDNILHAMSHLMNCVSIEMKLAAT
YGQTTRYALLSDILLAVNSETQRNGHSLPLEMSNNMLTPPSTNHFGDVLPAGRTMLQTTS
LGLHVNRLLDCLTLETQTLVQPSLEFFDERLLSNLLVDCEAKGSMGGAGMINIHKLHDIL
HDELRHVQSTIASGQRKSIVNEITVLLQYAIQLNGVRMQRFATYSYMSAWCNLVQVLFSI
MPDTVLPVSVRKQHIIDIIEKIMLKVEPQQPLIKISIQVTDTMLLLSANLRHCYYQLEDQ
RSLDEHGNVVCLSDMPSSVENSSQRNAHQRRSSSSGSNNNNNNSNTNNTNNNINNNNNNN
NNNNNNNNNNNNNNMSSNSCSSSNLRFILKRLIDWIMTCEVKSQKLSINLYASLLNCLRI
VKRVRSEAQVEYDETFLARTDGYKSQRSPDGGEMFQKEMAAEIISSMGDKLIDTICHDAI
TGHDVCSMLALSCLDLISELRAFGTLSDTVAQRGYLKHILSSLAKSDEQLREVLKPMPHN
LRPLFVYESCMAFLTQMAQTHQGATLLLAEGALGVLSNMSIYDMQPDIKASELERNVPGN
FMPAIDARFRSILMPALSLCDSIIDSLGISNNSASLQVLNFLFAHIEMIEGMLRAASPFM
HLGYLKLLATVTNLFARTTTYDVSTIEKCLNIHHDVEMNNRLSRLQQLMIVVFGRFTINE
ATIRRMLHQERTQTDLPDLSEEQKSQHVKFFLDITANLSLFCRHAVTSHVRDGITSKYLI
TTMINDVTPLSGKSDCKKLTAVMQIILNQLKGAIAYFLSQKSIADNLVQQRASLPNITFG
PSGKQNYLELSQRHNEKHNELLLAVFIAEQNLYLLWIHLDFYFRNAVIYSQENRTSINET
CLDPNNMSVLNASQDEITQLKQMLISSFNETFCTQLITASEEYSLKCKNFNTALLRRIKA
LVQFAPQIC
NT seq 6150 nt NT seq  +upstreamnt  +downstreamnt
atggatggtggtgtgctcgaggacatgtggacgccgtacaagcgtctgtacgatatatgc
cagttggccataaggaatcccaatgaggtcacggccgattttgagctatgcctcaaaaag
tataaacagaactttaccaattttctgcgcaatccgccgaagagtgagaagagccgttca
cacttgcgcaatgcgctgctggagggtgtcatgctggcagggcaatcgcgtaaagtggaa
ctctcacaggaaataattgatgaggccatcatattgtccgatatgtttgatttggatgag
atcttcgccttggagctgctatgcacggcacagcgtcaacaggtgcatcatccgggccta
ccgcgcggtctggtcgcggtattgctttactatgatggtcgcaaggcaatcacttgtaca
ctgcgcgacatgtttcaggctgtgagcggcgtttcctggagcaccgaactgcccagagag
atgaccgccttgatcaacaactactgccagaatcttgtagaagattccaacatacttggg
cgtctgctggagctgctagccgaaatggacatggagagggagattagtttactgaccaaa
aatcgagcctttggctcaaagaagcatcagaatcaggtactggccctctatgaggataca
cgcaaagccttggccatggccctattccattggtctgctcagcgtggcctgcccaaaaac
attgccatacgtttgctgcagcatttggccaatacgaagtcaaccgatgccgccggcaat
atggacgacgtaaccctaatcatgttgatggcattgctctatgcctacgatacctccgtg
ctgctgataaccgaatgcgatagtccgcatacggcacgcctgcccatactgagcgatccc
gattatgccaagtgtttctatgaggcaatctatgcgcagagcagctggcagactcagcat
ctggatgccattatcaagtatagctttggtttgacattggccagtctgcgacaggcgcca
agcgaactgcaggccaatgccggcgctctaatcaatcgggatgagcagcttattgacgag
gcgctggcggcaaatgtttttacctttttctatcgccagctactggagaagaatgtggtc
tatacaaccgaattcatttatcgccgcctacacctgctcatcacggattttatagatttc
atgcatgccaaggtatcggagctgcgcggtcgtgcggatgagacagctcgcacagtgatt
agctttcagaatgaaggtctcgaaccgccgccaaatctggatgtcaactttgagctcctg
atgctgtgcgtggccaagttgtatggcgataaacgtgccaccatcacgttatgcaacgag
tattggggtccaacggatacaacaacagccaacggtgtcgccaattatgttcaaaatacc
tcacgcgccgtctcactgttcaagtttatacgcttggccagcgagctgctgccgcaaact
ctgttcagatcctatttaaagatgattgctggcctaacacgcaccgaatttgcggcacgc
tgcgccttcaatctgctcaagaattcacagaacttgtcgtccacctatgccgtcagctgg
gatcatttcttcaatgcgctcaacaattatttcaacaacatgcgaaccgacttcgacagc
atggccaatgccggagattcgatttatcggagcactggcataccacgtaatatgacgcca
cgtgaaacggaacacatggctgctgtgatgggcattatgcaggccgtcgctgagaatgat
gaaatatcgcgaattatgctctgtgagcaggccaattggcagacgccgcaggtgctgctc
ggcctggtggcctgctcgacgccggtaatgcttaagggcgaaattttgtttacgctggcc
gcgctcagtcggtccaaggagacggcgcgcaccatttggtttcatttggaggaatcgcaa
attatacccaccgttacgatggtgtccagtgcccatgccgagtttagtctggccgaggaa
attgatcagaatgaaagccgtctggagacgtacaagctgacccgcggcattctgcagctg
ttgtatacgctgatgaccacacacatgccgcgcagcctgggctgtggtccgcgcaagccc
ggctatgatccgtatttgaaatttgttgtcgaatccatattgctgaagttctacaatcgt
gcgtataaggatcccacagagaaatgggctgtgggcaccaaatgtctgaagctattgtat
tttctgttggccagctatcggccgaaggcctcagattttgtggaacaacgcgatgagcat
gcgtatcccggctatcacataatgctccagctgcaggtcaaatcggatatgttgcgcctg
gtgttgcgtatcattgaggaggcacgcgaacgtctcgacgattacaatcaattcaatggc
aaggagttgctcgaggagtgcgcactttatgccttgctgctgcttgaggtggccctggcc
aaacagaatgccttcttcgaggcgcacgcaacggccaattgttcgatattgttgcttggt
cttaatcgcatgctcctcgatttgaatccgcgcagccgcagtcccgactatgttctcaat
attgtcaaatttgttacattcaacagttggctgccgcgtcatgcattggcctcaattaag
atcctgagcgcggtcagcatgctgccggatgtggtcagccagatattgaatatgtatgcc
catggcagcaccgagaagctggagatacgtcagagatttgtcgaatgcctcgaaatggat
atgcgtcgcggctcgccgctaaatgacgatgagctaacagatcaatttattggtattgat
caatttggttatccgctcgatggcaatctcaatgagaccgatttgcatgtggatctggag
gcactcggctttcgcaagccgcagcgcattgagctgcagatcaaggaggccattgttgag
ctattcgaggtcaatcttagccagccaatgcccaatttcgtttactttctgcttggcatc
gatgtaatacgcgacattctgggcaatgagaagcaacaacttggtctcgacgtcaactgt
tcctgcatcaattcactggtcctgctgctcgagcgttatctagagcaacagcgccacagc
gacgattattgcgagcacacggcccacattgtcgaacggatttatcatctctttcatgga
ctgtgcgcccatcgacgcacctcggaggcgattttacgctacttccgattgacctgcaat
gactttctgttgcgccatttgaccgcaatgccgttccgtcattttggcgaggataatatc
ttgcacgcgatgagccatctgatgaactgtgtatcaattgaaatgaaattggctgccaca
tacggccagacgacacgctatgccctgctgtcggacatcctgttggccgtcaattcggag
acgcaacgcaacggtcacagtttgccgctggagatgagcaacaatatgctgacaccgccg
tcaaccaaccattttggtgatgtcctgccggccggtcgtacaatgttgcagacaacatcg
ttgggcctccatgtgaatcgtttgcttgactgtctcacgctggagacgcaaactctcgtc
cagcccagtctggagtttttcgatgagcgtctgttgagcaatttattggtcgattgcgag
gcaaagggcagcatgggtggcgccggcatgataaatatacacaagctccatgatatactc
catgatgagctgcgtcatgtgcagagcaccattgccagcggtcagcgtaaatcgattgtc
aatgagataaccgtgctgctgcaatatgccatccaattgaacggggtgcgcatgcagaga
tttgccacctatagctatatgagcgcctggtgtaatctcgtccaggtgctgttcagcata
atgcccgatactgtgctgccggttagtgtgcgcaaacagcatattatcgatatcatcgag
aagatcatgttgaaggtggaaccacagcagcccttgattaagatctccatacaggtaacg
gatacgatgctcttgctgtccgccaatttgaggcattgttactatcagctggaggatcag
cgttcccttgacgagcatggcaatgtcgtttgtcttagtgatatgcccagctctgtggag
aacagcagccagaggaatgcccaccaaagaaggagcagcagcagcggcagcaacaacaac
aacaacaacagcaacacaaacaataccaacaataacattaataataataacaataacaac
aacaacaacaacaacaataataataataacaacaacaataacatgagcagcaacagctgc
agcagcagcaatttacgcttcatactaaagcgtctcatcgactggatcatgacctgcgag
gtcaagtcacagaagctaagcatcaatctgtatgcctcgctgctcaattgcctgcgcatt
gtgaagcgtgtgcggagcgaggcgcaagtggagtatgatgaaacatttttagcccgcacg
gacggctataagagccagcgcagcccggacggcggagagatgttccaaaaggaaatggcc
gccgagataattagcagcatgggcgacaaattgattgacaccatttgtcatgatgccatc
actgggcacgatgtgtgcagcatgctggcgctctcctgtctggacctcatatccgagctg
cgcgcgttcggcacgctgagcgacacggttgcccaacgtggctatttgaagcatatactg
agcagcctggccaaatcggatgagcagctgcgcgaggtgctcaaaccaatgccacataat
ctgaggccgctatttgtatacgaatcgtgcatggcattcctaacgcaaatggcgcaaaca
catcagggcgctaccctgcttctagccgagggtgcgctcggcgtgctctccaatatgagc
atctatgatatgcagccagatattaaggccagcgaactggagcgtaatgttcctggcaat
tttatgccagccattgatgcgcgtttccgttccatattgatgcccgcattatcgctatgc
gatagcataattgattccctcggcattagcaacaatagcgcctcgttgcaggtgctcaat
tttctgttcgcacacattgaaatgattgagggcatgctgcgtgccgcatcgccatttatg
catttgggctacctaaagctgttggccacggtcaccaatctgtttgcccggaccacaacc
tacgatgtgtccacaattgagaaatgcctcaatatccatcacgatgtcgagatgaacaat
cgcttgagccgtctgcaacagctgatgattgtcgtatttggtcgtttcacaattaatgag
gcgaccatacgacgcatgctgcatcaggagcgcacccagaccgatctgccggacctgtcc
gaggagcaaaagagccagcatgttaaattctttttagacataaccgccaatctatcattg
ttctgccgccatgccgtaaccagccatgtccgggacggcatcacctccaaatatctgatc
acaaccatgattaacgacgtgacaccgctttcgggcaaatcggactgcaagaaactgacc
gccgtcatgcagatcatattgaatcagctaaaaggtgccattgcctattttctgtcacaa
aaatcaattgccgacaatctggtgcagcagcgcgcctccctgcccaacataacattcgga
cccagcggcaagcaaaactatttggaactaagccagcgccacaatgagaaacacaacgaa
ctgctgctggccgtttttatagccgaacagaatttgtacctgctctggatacatttggat
ttctatttccgcaatgcagtcatctattcccaggagaatcgcacttctataaacgaaaca
tgtttggatcccaacaacatgtccgtactgaacgcctctcaggacgagataacgcagctg
aagcaaatgcttatctcgagttttaatgaaacattctgcacacaactaatcactgccagc
gaagaatattctttgaaatgcaaaaactttaataccgcgcttttgcgtcgcattaaagcg
cttgtccagtttgccccgcaaatctgctga

DBGET integrated database retrieval system