KEGG   Drosophila virilis: Dvir_GJ16601Help
Entry
Dvir_GJ16601      CDS       T01066                                 

Definition
GJ16601 gene product from transcript GJ16601-RA
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
dvi  Drosophila virilis
Pathway
Purine metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dvir_GJ16601
Enzymes [BR:dvi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     Dvir_GJ16601
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     Dvir_GJ16601
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 430 aa AA seqDB search
MPATTTTTTIDGYKLGKVLIEGKTKQVYNLPEHPGLCLLLSKDRITAGDGVKAHDLAGKA
EISNTTNGQVFRLLNEAGVRTAYVKQCGAKAFIARECQMIPIEWVTRRLATGSFLKRNVG
VPEGYRFSPPKQETFFKDDANHDPQWSEEQIISAKFELNGLVIGQDEVDIMRRTTLLVFE
ILERAWQTKNCALIDMKVEFGVDSGGNIVLADIIDSDSWRLWPAGDKRLMVDKQVYRNLT
SVTSTDLDTVKRNFIWVSEQLADIVPRKDHLIVVLMGSASDTSHSEKIATSCRSLGLNVE
LRVSSAHKGPEETLRIVREYESVMQNLIFVAVAGRSNGLGPVVSGNTNYPVINCPPVKSD
NMQVDVWSSLNLPSGLGCATVLYPEAAALHAATILGLSNFMIWSKLRVKQLNNFVTLKKA
DKELRGVRNV
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgccagccacaacaacaacaacaacaattgatggctacaagctgggcaaggtgctcatc
gagggcaaaacgaagcaggtctacaatctgcccgaacatcctggcctctgtctgctgctc
agcaaggatcgcatcacagccggcgatggcgtcaaggcgcacgacttggccggcaaggcg
gagatctccaatacgaccaatggccaggtatttcgcctgctcaacgaggccggcgtacgc
accgcctatgtgaagcagtgtggggcgaaggcttttattgcccgcgaatgccaaatgata
cccattgagtgggtaacccgacgtctggcaactggctcctttctcaagcgcaatgtgggc
gtgcccgagggctacagattctcgccgcccaaacaggagacattcttcaaggatgacgcc
aatcatgatccacagtggagcgaggagcagatcatttcggccaagttcgagctaaacggt
ctggtgatcggtcaggatgaggtggacatcatgcgacgcacaaccctgctcgtctttgag
attctcgagcgggcgtggcagacaaagaactgtgccctgatcgacatgaaggtcgaattt
ggcgttgactccggtggcaatattgtgctcgccgatatcatagattcggactcgtggcgc
ctctggccggctggcgacaagcgtctaatggtcgacaagcaggtctatcggaatttgaca
tcggtgacgagcaccgatctggatacggttaagcgcaactttatctgggtatcggaacag
ctggccgatattgtgccgcgcaaggatcacttgattgtggtgctcatgggcagcgcatcg
gatacatcgcacagcgaaaagattgccaccagctgccgttcgttgggcctcaatgttgag
ctgcgcgtcagctcggcccacaagggtccggaggagacgttgcgcattgtccgtgaatat
gaatcggttatgcagaatctaatctttgtggccgttgccggacgttcgaatggcctcgga
ccggttgtatccggcaatacaaactatccggtaatcaactgcccgccggtcaagtccgat
aacatgcaggtggacgtctggtccagcctcaatttgccatcgggcctgggctgtgccacc
gttctctatccggaggcagctgcgctgcatgcggccaccattttgggactgagcaatttc
atgatctggtccaagctgcgcgtcaagcagctcaacaatttcgtgaccctcaagaaggcc
gacaaggagctgcgcggcgtgcgcaatgtctga

DBGET integrated database retrieval system