KEGG   Drosophila virilis: Dvir_GJ16711Help
Entry
Dvir_GJ16711      CDS       T01066                                 

Definition
GJ16711 gene product from transcript GJ16711-RA
Orthology
K08738  
cytochrome c
Organism
dvi  Drosophila virilis
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dvir_GJ16711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 104 aa AA seqDB search
MGADAENGKKIFVQKCAQCHTAEAGGKHKQGPNLGGIVGRKCGTAAGYKYTDANIKKGIV
WTDANLDEYLKDPKKYIPGTKMVFPGLKKAEDRADLIAYLKSNK
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctgatgcggagaatggcaagaagatctttgttcaaaaatgcgcccaatgccac
acagctgaagctggcggcaagcataagcagggacctaatctgggcggaattgttgggcgc
aaatgcggcactgcggctggctacaaatatactgatgctaatatcaagaagggcatcgtc
tggacagacgcaaatctggatgagtatttgaaggatccaaagaaatatatacccggcact
aaaatggttttccccgggctcaaaaaagctgaggatcgcgcagatttgattgcttacctc
aaatcaaataaataa

DBGET integrated database retrieval system