KEGG   Drosophila virilis: Dvir_GJ16722Help
Entry
Dvir_GJ16722      CDS       T01066                                 

Definition
GJ16722 gene product from transcript GJ16722-RA
Orthology
K08738  
cytochrome c
Organism
dvi  Drosophila virilis
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:dvi00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 108 aa AA seqDB search
MGVPAGDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAPGFAYTDANKAK
GITWNEDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSATK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtaccagctggtgatgttgagaagggcaagaagctgttcgtgcagcgctgcgca
cagtgccacaccgtcgaggccggtggcaagcacaaggtgggccccaatctgcacggtctg
atcggtcgcaagaccggccaggcgcccggcttcgcgtacacagacgccaacaaggccaag
ggcatcacctggaacgaggacacactcttcgaatatctggagaaccccaagaagtatatc
cccggcaccaagatgatcttcgccggcctgaagaagcccaatgagcgtggtgatctgatc
gcttacctgaaatcggctaccaagtaa

DBGET integrated database retrieval system