KEGG   Drosophila virilis: Dvir_GJ16786Help
Entry
Dvir_GJ16786      CDS       T01066                                 

Definition
GJ16786 gene product from transcript GJ16786-RA
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dvir_GJ16786
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 996 aa AA seqDB search
MSTEELKEREYGAALEDEENPYAIGAKPPRTPVDDAAAELNASLDISGSTEPSDGDEGWA
DRSHETSAASEQCDTTDETVQAPAPVPVPVPVPVAIPMPPRPQTYLGAHHSPVSEEEEEN
SSASSSSSGEHSGESAAVRSDDASDDSDDEASPTTVVDVSDLTGNDDYSCGPTAENVENV
AESGTEAAKAAETEQIAAEALPEGEEPMEVEGQPITEMEADTDAEMATATGIEEAVDVAE
MQIEGEVEAETETEMVAPAEVPETPESPTDDGEEPIDLLPPYKRGRYISVHADDHQRLAA
ELAQQQQQQQQQQQQQQLQQQQQQQQLQQQQQQLQQQQLQQQQLQQQQRQQQLQQQLQQQ
QLQHQQHLQQQQRQQQQLQQQQLLHQRQQQQLQQQQRQRQQQRVAAQMQPPLLLDEFESI
SSSSEEDNSSVEGDDEEDEEDGSSDDDDDDDDDDGDEDKGEDEDEDDSDSSESSSSSDES
DDDDVILVEQDSTSGETVTATETTDDGEPSIDKLDISDNPEKIYYIRRADGTVHAGQVLQ
SRVTDNCVSPNEYYVHYVGLNRRLDEWVGRHRISDNAEDLGGITVTSEPAELLACDQPST
SASASASASASASASASTSASASASTSASASASSSSANSQQSSGSMMRRKRQGHKDYYLS
ACENNRYDYSDRKMTRYQKRRYDEINHVQKSHAELSASQAALEKEHEFITKIKYIDKLQF
GNYEIDTWYFSPFPGEYGKARILYVCEYCLKYMRLERSYKYHLGECEVRRPPGKEIYRKS
TISIFEVNGKDQPLYCQLLCLMAKLFLDHKVLYFDMDPFYFYVLCETDKMGSHIVGYFSK
EKRSLENNNVACILVLPPHQRKGYGKLLIAFSYELSRKEGVIGSPEKPLSDLGRLSYRSY
WAYTLLELMKGRCSAEQTSIAELSEASGITPDDIIYTLQSMKMIKYWKGQNVICVTAKTI
NDHLQLPQFKRPKLTIDLNYLNWKPHAPLPPLQRLQ
NT seq 2991 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgaggaactaaaagaacgtgaatatggtgccgcattggaggacgaagagaat
ccatatgcgattggcgccaaaccgccacgaacgccggtagatgatgcggccgccgagctg
aatgccagcctggacatcagcggctcgacggagccctcagacggggatgagggctgggca
gatcggtcgcatgaaacgagtgccgcatccgagcaatgtgatacaacagacgaaacggtg
caggcgccggcgccggttccggtcccagtgccggtgccggtggcgataccgatgccgcct
cgaccgcaaacatacttgggcgctcaccatagtcccgtgtcggaggaagaggaggagaac
agcagcgcaagtagttcaagcagcggcgagcacagcggcgagtcggccgcagtacgttcc
gacgatgccagcgatgactcggacgatgaggcttcgcccaccaccgtggtcgatgtgagc
gacttgaccggcaacgatgactacagctgcggtccgactgctgaaaatgtggaaaacgtt
gccgaatccggtacggaggcagccaaagcagcggaaactgagcagatcgcagcggaagcc
ttgcctgaaggcgaagagccaatggaggttgagggccagccaataaccgagatggaagcg
gatacggatgcggaaatggcaacggcaacgggcatcgaggaggcagtggacgtggcggaa
atgcaaatcgaaggtgaagtggaagcagaaacggaaacggaaatggttgcgccagcggaa
gtgcccgaaacgcccgaatcgccgactgacgatggcgaggagcccatcgatctgctgccg
ccctacaagcgcggacgctacatatccgtgcacgccgacgatcaccagcgactcgccgca
gaactggcccaacaacaacagcagcagcaacaacaacagcagcagcaacagctgcagcag
cagcagcagcaacaacaactgcaacagcaacagcaacaactgcaacagcaacaactgcaa
cagcaacaactgcagcagcaacaacggcaacagcaactgcaacagcaattgcaacagcaa
caactgcaacatcagcaacacctgcaacagcagcagcgacaacaacaacagctgcagcaa
cagcaactgctacatcaacgacaacaacaacaactgcagcaacaacagcgacagcgacaa
caacaacgggtggcggcacagatgcagccgcccctgctgctagacgaattcgagagcatc
tcgagcagcagcgaggaggacaacagcagcgttgagggcgacgacgaagaggatgaggag
gatggcagcagcgacgacgacgatgacgacgatgacgatgacggcgacgaggataaaggc
gaggatgaggacgaggacgacagcgacagcagcgagagcagcagcagcagcgacgagagc
gacgatgatgatgtcatattggtggagcaggatagtacatcgggcgaaacggtaaccgca
acggagacaaccgatgacggtgagccctcgatcgataagctcgatattagcgacaatccg
gaaaagatctactatataaggcgcgccgatggcaccgtgcacgccggccaggtgctgcag
tcgcgcgtcaccgacaactgcgtcagtcccaacgagtattatgtgcactatgtgggcctg
aatcgacgcctcgacgaatgggttggccggcatcgcatatcggacaatgcggaggatctc
ggcggcataacggtgaccagcgagccggccgagctactggcctgcgatcagcccagcaca
agtgccagtgccagtgccagtgccagtgccagcgccagtgccagcgcgagcaccagtgcc
agtgcgagcgctagcaccagcgccagcgcgagcgcgagcagcagcagcgccaacagccag
cagagctccggcagcatgatgagacgcaagcgacaggggcacaaggattactatttgtct
gcgtgcgagaacaatcggtacgattacagcgaccgaaagatgacgcgctaccagaagcga
cgctacgatgagattaatcatgtgcagaagagccatgcagagctgagcgcctcgcaggcg
gcgctcgagaaggagcacgagttcatcacgaaaatcaaatacattgataagctacaattt
ggcaattatgaaattgacacctggtactttagtccctttccgggtgagtacggcaaggcg
cgcattctgtacgtgtgcgaatattgcctgaaatacatgcgtctggagcggagctacaag
tatcatttgggcgagtgcgaggtgcgccggccgccgggcaaggagatctatcgcaagagc
accatctccatattcgaggtgaacggcaaggatcagccgctctattgccagctgctgtgc
ctgatggccaaactgtttctcgaccataaggtgctctattttgatatggatcccttttat
ttctatgtgctctgcgagaccgacaagatgggcagccacattgttggctacttctccaaa
gagaagcgttccctcgagaacaataatgtggcctgtattctggtgttgccgccgcatcag
cgcaagggctatggcaagctattgattgccttcagctatgagctgtcgcgcaaggagggc
gtcattggcagcccggagaagccgctctccgatctgggcaggctcagctatcgcagctat
tgggcctatacgctgctggagttgatgaagggacgctgctcggcggaacagacgagcata
gcggagctgagcgaagccagcggcattacgcccgacgacatcatctataccctgcaatcc
atgaagatgatcaagtactggaagggccagaatgttatctgtgtaacggccaagaccatc
aacgatcatctgcagctgccccagtttaagcgacccaagctgaccatcgatttgaattat
ctcaactggaagccacatgcgcctcttccgccgctccagcggctccaatag

DBGET integrated database retrieval system