KEGG   Drosophila virilis: Dvir_GJ16814Help
Entry
Dvir_GJ16814      CDS       T01066                                 

Definition
GJ16814 gene product from transcript GJ16814-RA
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dvir_GJ16814
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1229 aa AA seqDB search
MSSPDDRIPIRDLPPEAGNDERLLHITPGVISLDFKPRQVDIDQQILELKKSQELQKQRL
FHSYQEQTKQMELEHKMQLEHKYHFAVHSHGAFQELREQSMEQHRQQQQQHQQQHQQQQQ
QQQQQQQQHQQQHQQQQQQQQQQRERREREVMKRKENCSANASPEVKQILSCFLMSRKSQ
AVAPNGTTTTSPYRNRGVVKSSSGESLPAGTVTSAHPYKIPQPPASLLKYESDFPLRKTA
SEPNLLKIRLKQSVIERKARIGGPAGARRHERLLQAAQRRHQKNSVLTNCNSTPDSGPNS
PPSSTGMSVGVVGSRGSPTSAPIQEENEEVNQYQPGQRSSINDLPLFSSPSLPNISLGRP
HLTNAQAGQANYAMFAALRQHVAATGAGGVPPVPVGVGVGVAGTPPTYYNPLAMSFGRQA
APPPPPPLSMMPATGIAPQPSPVVRSASATSTSSSQASLVGDTAPPQAHAASTILPSSSS
YMQLGGVSGASAVNLHAAAVAVAAAAAAAAGAGTLPPTNSHGHALYGHGQHNAHGQHAHG
HSGAGHVPITDAQVAQVHLHKQGHRPLGRTQSAPLPLGHPMLTGAGQLNVVQTHYENSEA
ERQAYEHQVLTQKLRQKVLTRSDAAAAAAAAAAIREPQLREEEDDDSAAEVMDLTDKKKP
PKTVLTSTIATSTSQNLPEALAAATYRAAAKSSKLRDQEYLQQQRELLFLQEEELAKGLM
RPLSRTLSSPLVPGHGLSQIPDTGQHPTPIVTSSSADHIPPVNLTLPHKRQLLGSVYAAQ
LRQQQQQQLVESSGLTHKKITTGLAYDPLMLKHACICGDNAPHPEHSGRLQSVWARLNET
DLVKRCDRLRARKATQEELQTVHTEAHAMLFGSNQGQLTRPKLESTLSASFVRLSCGGLG
VDLDTTWNEHHTAIAARMAAGCVIDLAFKTAKGDLRNGFAVVRPPGHHAEANLAMGFCFF
NSIAIAAKLLRQRVPEMKRILIDVHHGNGTQQAFYQSPDILYLSIHRHDDGNFFPGTGGP
TECGAGAGLGYNVNISWSGALNPPLGDAEYIAAFRTVVMPIAKCFNPDIVLVSSGFDAAT
GHPAPLGGYHVSPACFGLMTRELLQLANGKVVLALEGGYDLAAICDSAQECVRALLGDPA
APILPSELERPPCQNAINTLQKTIAIQQTHWPCVRLLEHTVGLSALEALKVEHEESETVN
AMAGLSMQSLHRTLSRDDSEEPMDQDETK
NT seq 3690 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtcctgacgatagaataccaatacgtgatctgccgcccgaagccggaaacgat
gagcgattgttgcacattacgccgggcgtcatatcgctggactttaagccgcgtcaagtg
gatatcgatcagcagattctagagctgaagaaaagccaggagctgcagaagcagcgacta
ttccactcgtatcaggagcagacgaaacaaatggaactggagcataaaatgcaattggag
cacaaatatcattttgcggtgcattcacatggcgctttccaggaattgcgggaacagagc
atggagcagcatcgccagcaacaacaacaacaccaacaacaacaccaacaacaacaacag
cagcaacagcaacaacagcagcagcatcagcaacagcatcagcaacaacaacaacagcag
cagcagcagcgggagcgaagggaacgggaggtgatgaagcgcaaggagaattgcagcgca
aatgcgagtcccgaagtcaaacagatactcagttgctttctcatgagccgcaaatcgcag
gcggtggcaccgaatggcacaacaacaacctcgccctatcgcaatcgcggcgtggtgaag
agctcctcgggcgaatccttgcccgcgggcaccgttaccagcgcacatccctataaaata
ccacagccgccggcctcactgctcaaatatgaatctgatttccccttgcggaaaacggca
tcggagccgaatctgctgaagatacgactcaagcagagcgtcatcgagcgcaaggcacgc
atcggtgggcccgcgggcgcgcggcgtcacgaacggctgttgcaggccgcccagcgaagg
catcagaagaactcggttctaacaaactgcaacagcacgccggattctggtcccaattcg
ccgccctcgtcgactggcatgtcagtgggcgtggtcggtagccggggctcaccgaccagc
gcacccatacaggaggagaacgaggaggtcaatcaataccagcccggccagcgcagcagc
atcaacgacctgccgctgttcagttcgccctccctgccaaacatatcgctgggacgtccg
catttaaccaacgcccaggcgggccaggccaactatgccatgttcgctgcactgcgtcag
catgtggcagctacaggcgctggcggcgtgcctccggtgcccgttggcgtcggcgtgggc
gtggctggcacaccgcccacctattataatccgctggccatgtcgtttggcaggcaagcg
gcgccaccgccgccgccgccgctctccatgatgcccgccacgggcattgcgccgcagcca
tcgccagttgtgcgctccgcatcggccacatcaacgtcctcgtcgcaggcatcgctggtg
ggggatacggcgccgccgcaggcgcatgccgcatccacaattctgccctcgtcctcgtcc
tatatgcagctgggcggcgtatctggcgcctcggctgttaatcttcatgctgccgctgtc
gccgttgctgccgccgctgccgctgccgctggcgccggcacattgccgcccacaaacagc
cacggtcatgccctgtatggtcatggtcagcacaatgcgcacggacagcatgcgcacggg
cacagcggcgccgggcatgtgcccatcacagacgcccaggtggcccaggtgcatctgcac
aagcagggccaccggccactcggacgcacccagtcggcgccgctgcccctgggtcatccg
atgctgaccggcgccggccagctgaacgtggtgcaaacgcactacgagaatagcgaggcg
gaacggcaggcctacgagcatcaggtgctcacacagaagctgcgccagaaggtgctgacg
cgaagcgatgccgccgccgctgcggcagccgctgcggcaatacgcgagccgcagcttagg
gaggaggaggatgatgattccgccgccgaggtcatggatctcaccgacaaaaagaagccg
cccaagacggtgctcacgagcacaattgcgaccagcacgtcacagaacttgccggaggcg
ctcgctgcagccacctaccgtgcggcggccaagtcgagcaagctgcgggatcaggagtat
ttgcagcagcagcgcgagctgctctttctgcaggaggaggagctggccaagggcctaatg
cgtccgctatcgcgcacgctgagcagccctctggtgccgggccacggcctcagccagata
cccgacacgggccaacatccgacgcccattgtcacctcatcatcggccgatcacataccg
cccgtcaatctgacgctgccccacaagcggcagctacttggcagtgtctatgccgcccaa
ctgcgacagcagcagcagcagcagctggtggagagctcgggactgacgcacaagaagatc
acgacgggactcgcgtacgatccgctgatgctgaagcatgcctgcatttgcggtgacaat
gcgccgcatccggagcacagcggccggctgcagagcgtctgggcgcgtctcaatgagacg
gatctggtcaagcgctgcgatcgcctgcgcgcccgcaaggccacccaggaggagctgcag
acggtgcacacggaggcgcatgccatgctctttggctccaatcagggccagctgacacga
cccaagctcgagagcacactctccgccagctttgtgcggctctcctgcggcggccttggc
gtcgatctggataccacctggaatgagcatcatacggcaattgccgcccgcatggccgcc
ggctgtgtcattgatttggccttcaagacggccaaaggtgatctgcgcaacggtttcgcc
gtcgtccgtccgcccggccatcatgcggaggccaatctggccatgggcttctgtttcttc
aactcgattgccatcgcagccaagctgctgcgccagcgcgtgcccgaaatgaagcgcatc
ctcatcgatgtgcatcatggcaatggcacacagcaagcattctaccaaagtcccgacatt
ctatatctttccatacatcgacacgatgacggtaacttctttcccggcacaggtggcccc
acagagtgcggcgccggtgctgggctcggctacaatgtgaacatctcctggtcgggcgca
ctgaatccaccgctgggcgatgccgagtatatcgctgcattccgtaccgttgtgatgccc
atcgccaagtgctttaatccggatattgtgctggtctcgtcgggcttcgatgcggccacc
ggccatccggcgcccctcggcggctatcatgtctcgcccgcctgctttggcctgatgacg
cgcgaactgctccagctggccaacggcaaggtggtactcgccctcgagggcggctacgat
ctggcggccatctgtgattcggcgcaagagtgtgtccgcgccctgcttggcgatccggca
gccccgatcctgccaagcgaactggagcgaccgccctgccagaatgccatcaacacgctg
cagaagaccattgccatacagcaaacgcattggccctgcgtgcgactcctggagcacacg
gtcggcctgtccgcgctggaggcgctcaaggtggagcacgaagaatctgaaacggtgaat
gccatggccggcctctccatgcagtcgctgcacagaacgctttcgcgtgacgattccgag
gagcccatggatcaggatgaaaccaaatag

DBGET integrated database retrieval system