KEGG   Drosophila virilis: Dvir_GJ16824Help
Entry
Dvir_GJ16824      CDS       T01066                                 

Definition
GJ16824 gene product from transcript GJ16824-RA
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
dvi  Drosophila virilis
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dvir_GJ16824
Protein kinases [BR:dvi01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [Table]
   Dvir_GJ16824
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2471 aa AA seqDB search
MSTSSIVQQFVNGLKSRNRNVQNKAAQDLFLYVKTELREMSQEELVQFFDDFDHHIFNMV
NATDINEKKGGALAMKCLISGDALITRKGISPYLNRLRDLLLINDVSVMEIAARSLVKLA
NMPGSKGAESFDFDIKKAFEMLSGDRQEYRRHAAVFILRELAIALPTYFYQQILTFFEHI
FNAIFDPKPAIRESAGEALRAALIVTAQRESTKQSSEPQWYKICYEEASSSFSSDVLTGK
EQKGMTRDDRIHGGLIVFNELFRCANAHWERRYTTLKMLFPKSQHNKFLEATNSSSVGNQ
LTTIVPRLKVPFVDKLGSTQMHMEGEQHNATGNKLTSQNVLESAYAHEILKEHFITICDN
VLEQRTSKSPYVQQALLQILPRLAAFNREVFVAQYLKTCVAHLMSILRGKEKDRNVAYIT
IGYIAVAVESDIEKHLKHIMGSIKQALPAKDLASKRKPPVDAAVFACITLLAHAVKSQIA
DDVREILEQMFHTGLSPALTVCLRELAENVPQLKSAITDGLIGILFQVLMNKPATIPYAT
MPPISIDASLLLQSADSPTIVLALRTLGTFNFEEQNMLDFVQRCADYFIVHEHQEIRLEA
VQTCTRLLKLAVQSSDSMENSKTLSDTVSHVIERLLSVAITDMDYNVRIRILRSLDETFD
AKLAQPESLNALFITLHDEIFEIRELAMVTIGRLSSMNPAYVMPKLRTTMIELLTDLKYS
GMSRNKEQSARMLDHLVISTPRLISSYMNPILKALVPKLHEPESNPGVVLNVLRTIGDLA
EVNGGSNEMELWADELLSILLEMLGDAGSPDKRGVALWTLGQLISATGRVVSPYHKYPVL
IDILINFLKTEQRRSIRRETIRVLGLLGAMDPYKHKMNKGLIDSQKDNVLIAYSDGKADE
SQDISTAELLVNMGSHALDEYYPAVAIAALMRILRDPTLSTRHTSVVQAVTFIFHTLGIK
CVPYLAQVLPNLLDNVRTADNNLREFLFQQLAILVAFVKLHIISYMDDIFKLIKEFWTIN
TPLHSTLINLIEQIAVALGCEFRDYLAQLIPQILRVLQHDNSKDRMVTRRLLQALQKFGS
TLGYYLPLIVPPIVKFFDSPYVPQQVSLVALETINSLAGQLDFTDFSSRIIHPLVRVLET
EPELREQAMTTLRSLVKQLGKKYLVFVPMVQRTINKHRIVDAEYEKLLDHIQSNSTLVDG
CGIGVGIGGDFGQRQAKPKYNEPFVLDSNSSSKNLKVSTNALRTAWQVTRRVSKDDWVEW
LKRLSIGLLKESPSHALRACCVLAQDYDTLLRDLFNAAFISCWTELSPEHRHELTQSLIQ
ALQVTDMPEITQTILNLAEFMEHCDRDPIPIETQLLGTHAMACRAYAKALRYKEEEFVPR
QEAHVFESLIHINNKLQQREAAEGLLTTYRNTASEGSVHGRWYEKLHNWDQALHHYQLNL
NADPNDLEARLGHMRCLEALGDWSQLSTRCKEEWPNFSTEAKSRASPLAAVAAWGLKDWD
GMQEYVRCIPVDTQDGSFYRAVLAVHHDDFETAQRLIDETRDLLDTELTSMAGESYERAY
GAMVCVQMLAELEEVIQYKLIPERREPLKAMWWKRLQGGQRLVEDWRRIIQVHSLVVKPH
EYIHTWLKYASLCRKSGSLYLSHKTLVMLLGTDPALAPDEPLPCNQPQVTYAYTKYLAAS
SQPQLAYKQLRDFVNTYSTQLSCLPSEALKQQDQRLMARCYLRLATWQDKLHENRPNPDA
VQGALECFEKATNYDPNWYKAWHLWAYMNFKVVQSQKQVLENQRQQSPASMGLGLDSEHL
IIQQYAVPAVQGFFRSISLIRGNSLQDTLRLLTLWFDYGHHAEVYEALFSGMKMIEINTW
LQVIPQLIARIDTHRKLVGQLIHQLLMDIGKNHPQALVYPLTVASKSASLARKNAAFKIL
DSMRKHSPTLVEQAVMCSEELIRVAILWHEQWHEGLEEASRLYFGDRNVKGMFEILEPLH
AMLDRGPQTLKETSFSQAYGRELTEAYEWTQRYKTSAVLMDLDRAWDIYYHVFQKISRQL
PQLTSLELPYVSPKLMTCKNLELAVPGSYNPGQELIRINHIKTNLQVITSKQRPRKLCIR
GSNGKDYMYLLKGHEDLRQDERVMQLFSLVNTLLLDDPDTFRRNLAIQRYAVIPLSTNSG
LIGWVPHCDTLHTLIRDYREKKKVPLNQEHRTMLNYAPDYDHLTLMQKVEVFEYALGQTQ
GDDLAKLLWLKSPSSELWFERRNNYTRSLAVMSMVGYILGLGDRHPSNLMLDRMSGKILH
IDFGDCFEVAMTREKFPEKIPFRLTRMLIKAMEVTGIEGTYRRTCESVMLVLRRNKDSLM
AVLEAFVYDPLLNWRLLDVDKKANDTTATTAAGASGGSPSNSIEQESLLQGNPLAKSKTY
EAQQLHVGYTNVADVTNSKASMVIQRVNRKLTGTDFQMTEMTEQQQVELLIQQATNNENL
CQCYIGWCPFW
NT seq 7416 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacatcctcgattgtgcagcagttcgtcaacggactcaaatcacgcaatcgcaat
gtgcaaaacaaggcggcacaggacctgttcctgtatgtcaaaacagagctgcgcgagatg
tcgcaagaggagctggtgcaattctttgacgacttcgatcatcacatcttcaacatggtc
aatgcaacggacatcaatgagaagaaaggcggcgccctggctatgaagtgtctcataagc
ggtgacgcgttgatcacgcgcaaaggcatctcgccgtaccttaatcgattgcgcgatctg
ctgcttatcaatgatgtgtccgtcatggaaattgcggcacgttccctggtcaagctggcc
aatatgcccggctcgaagggcgcggaatcctttgacttcgacatcaaaaaggcctttgaa
atgctcagcggcgaccgacaagagtatcgccgtcacgcggccgtctttattctacgtgag
ctggcaattgccttgcccacatatttctatcagcaaattcttacgtttttcgagcacatc
tttaatgccatctttgatccgaagccagcgatacgcgaatctgccggcgaggccctgcgc
gccgcactcattgtgaccgcccagcgtgagagcacaaaacaatccagtgagccgcagtgg
tataagatctgctatgaagaggccagcagcagcttcagcagcgatgtgctcacgggcaag
gagcaaaagggcatgactcgcgacgatcgcatacacggcggcctcattgtcttcaatgag
ctatttcgttgcgccaatgcgcattgggaacgccgatatacaacgcttaagatgctcttt
cccaagtcgcagcacaataaatttctggaagcgactaattcctcatcagttggcaatcaa
ctgaccaccattgtgccacgcctcaaggtgcctttcgttgataaactgggcagcacacag
atgcacatggagggcgagcagcacaatgcgacgggcaacaagctgacgagtcaaaacgta
ctggagtccgcctacgcccacgagatacttaaggagcacttcataaccatatgcgacaat
gtgctggagcagcgcacctcaaagtcgccatatgtgcagcaggcgttgctgcagatcttg
ccccgtctggctgcctttaatcgcgaagtgtttgtggcgcaatatttgaaaacttgtgtg
gcccatttaatgtcgatattgcgcggcaaggaaaaggatcgcaacgtggcatacatcacc
atcggctacatagccgtggccgtcgagagcgatatagagaaacatctgaagcatattatg
ggcagcattaagcaggcgctgccagccaaggatttggccagtaaacgcaaaccgcctgtc
gatgcggcggtctttgcctgcattacgctgctggcgcatgcggtcaagtcacaaatcgcg
gacgatgtccgcgaaattcttgagcaaatgtttcacacaggcctctcgccagcgctgacc
gtttgtctgcgcgaactggccgagaatgtgccgcaactgaagtcagctattacggatggc
ctgattggcattctctttcaggtgctaatgaataagccggcaaccataccatatgccaca
atgccgcccatcagcattgatgcctcgctgctgctccagagtgccgatagccccacaatt
gtgctggctctaaggacattgggtacctttaatttcgaggaacagaacatgctcgacttt
gtgcagcgctgcgcggattactttattgtgcacgagcatcaggaaatacgcctggaagcg
gtgcaaacctgtacgcgtctgctcaagctggccgtgcagtcgtcggacagcatggagaac
tcaaagacgttgagcgacacggtctcgcatgtgattgagcgtctgctgtcggtggccatc
accgacatggattacaatgtgcgcattcgtatacttcgctcgctggacgaaacttttgat
gccaagctggcgcaaccggagtcgctaaatgcgcttttcataaccctgcacgatgagatc
ttcgagatacgcgaacttgccatggtcaccatcgggcggctgtcctccatgaatcccgcc
tatgtcatgccaaagctgcgcaccaccatgattgagctgctcacggacttgaagtactcg
ggcatgagtcgcaacaaggagcagagcgcacgtatgctggatcatctagtcattagcacg
ccgcgtcttatttcatcctatatgaatccaatactgaaagcgctcgtgcccaagctgcac
gagccagagtctaatcctggcgtggtgctcaatgtgctgcgcaccattggcgatctggcc
gaggtcaatggcggctccaacgaaatggagctgtgggcagatgagctgctctccatactg
ctcgagatgctgggcgatgcgggcagcccggacaagcgtggcgttgcgctctggacactc
ggccagctgataagcgccacagggcgtgtggttagcccctatcacaagtatccagtgcta
atcgatatactgattaatttcctaaagaccgagcagcgtcgctccatacgccgcgaaacg
atacgcgtgctgggcctgcttggcgcaatggatccgtacaagcataaaatgaataagggc
ctgattgatagccaaaaggataatgtgctaattgcctactcggatggcaaggcggacgag
agccaggacatttccacggccgagctgcttgtgaacatgggctcccacgcactggatgag
tattatccagctgtggccattgcggcgctcatgcgcatcctccgcgatccaacacttagc
acacgtcacaccagcgtcgtgcaggctgtcaccttcatctttcatacgctgggcatcaag
tgcgtgccgtatctggcacaggtgctgcccaatttgctggacaatgtgcgcaccgcggac
aataatctgcgtgagttcctcttccagcagctggccattctggtggcctttgtcaagctg
cacatcatcagctatatggacgacatctttaagctgatcaaggaattctggaccatcaat
acgccgcttcactccacgctcatcaatctaatcgaacagattgccgttgccctgggctgc
gagtttcgggattatctggcgcagctcataccgcaaattttgcgtgtgctccagcacgac
aactccaaggatcgaatggttacacggcgactgttgcaggcgctgcagaaatttggcagc
accctgggctattatttgccactaattgtgccgcccattgtcaagttctttgactcgccc
tatgtgcctcagcaggtgtccctggtggcgctggagacgatcaacagtttggctggccag
ctggattttacggacttctcctcgcgcataatacatccgctggtgcgtgtactggaaacg
gagccggagctgcgcgaacaggcaatgaccacgctgcgctctctggtcaagcagctgggc
aaaaagtatctggtttttgtgcccatggtgcagcgcaccatcaacaagcatcgcatcgtg
gatgccgaatacgaaaagctgctcgaccacattcaatccaacagcaccttggtggatggc
tgcggcattggcgttggcattggcggcgacttcgggcagcgccaggcgaagcccaaatac
aatgagccctttgtgctggacagcaacagcagcagcaagaatctgaaagtgtccacaaat
gcgttgcgcaccgcttggcaggtgacgcggcgcgtctccaaggatgactgggtggagtgg
ctgaagcgtctgtccataggcctgctcaaggagtcgccatcgcatgccttgcgcgcctgc
tgtgtgctggcccaggattatgatacgctgttgcgggatttgtttaatgcggccttcatc
tcatgctggactgaactctcgcctgagcataggcacgagctaacccagtcactgatacag
gcgctgcaggtcacggacatgcccgagatcacgcagaccatactcaatctggccgagttt
atggagcactgcgatcgcgatcccatacccattgagacacagttgcttggcacacatgcc
atggcgtgtcgagcgtatgccaaagcattgcgctacaaagaggaggagtttgtgccgcgc
caggaggcgcatgtctttgagtcgctcatccatattaacaacaagctgcagcagcgcgaa
gccgccgaaggtctgctcaccacctaccggaacacggcgagcgagggcagcgtccacgga
cgctggtacgagaagctgcacaactgggatcaggcactgcatcactatcagcttaatctg
aatgctgatcccaatgatctggaggcgcgtctggggcatatgcgctgcctggaggcgctt
ggcgattggtcccagctgagcaccagatgcaaagaggaatggcccaactttagcacggag
gccaaatcgcgcgccagtcccttggctgccgttgccgcctggggcctaaaggattgggat
ggcatgcaggaatatgtacgttgcatacccgtggacacacaggacggcagcttctatcgc
gctgtgctcgccgtgcatcacgatgactttgagacggcccagcgtctaattgacgagacc
cgcgatctgctggacaccgagctgacctccatggccggcgagtcgtacgagcgtgcctat
ggcgccatggtctgcgttcagatgctggccgaactggaggaggttatacagtacaagctg
ataccggaacgacgcgaaccgctcaaggccatgtggtggaagcgtctgcagggcggacag
cgtttggttgaggattggcgccgcattatccaggtgcactcgttggtagtaaagccgcat
gagtatatacacacctggctaaagtatgccagcttgtgccgcaagagcggctccctatac
ctgtcgcacaagacgctggtcatgctgctgggcactgatccagctctggcgccagatgag
ccgctgccgtgcaaccagccacaggtcacctatgcctacaccaaatatctcgccgcctcc
tcacagccacagttggcgtacaagcagctgcgagacttcgtcaacacgtacagcacgcag
ctgagctgcctgccgtcggaggcactgaagcagcaggatcagcgtctgatggcgcgctgc
tatttgcgcttggccacctggcaggacaaactgcacgagaacagacccaatccggatgca
gtgcagggggctctggagtgcttcgagaaggccaccaactatgatcccaactggtacaag
gcgtggcatctgtgggcctacatgaacttcaaggtggtgcaatcccaaaagcaggtactg
gaaaatcaacgccagcaatcgccggcatccatgggcctgggcctggacagcgagcatctg
atcatacaacagtatgcggtgcctgcggtgcagggcttcttccgctccattagcctaatc
cgtggcaattcgctgcaggatacgctgcgtctgttgacgctctggttcgactatggacac
catgcggaggtctatgaggcgttgttctcgggcatgaaaatgattgagattaacacctgg
ctgcaggtgataccacagctaattgcccgcatcgatacgcatcgcaaactggtgggtcag
ctaatccatcagctgctcatggacattggcaagaatcatccgcaggcactcgtctatcca
ctgaccgtagcctccaagtccgcatcgctggcgcgcaaaaatgccgccttcaagatactc
gactcgatgcgcaagcactcgcccacgctggtcgagcaggcggtcatgtgcagcgaggag
ctgatacgcgtggccatactctggcacgagcagtggcacgagggcctggaggaggcttca
cgcctctactttggagatcgtaatgtcaagggcatgtttgagattctggaaccgttgcac
gccatgctggaccgcggcccacagaccctcaaggagacctccttctcgcaggcctacggc
cgtgagctgaccgaggcgtatgagtggacgcagcgttataagacgtcggctgtgctcatg
gatttggatcgtgcctgggatatatactatcatgtgttccagaagatatcccgccaactg
ccgcagctgacatcgctggagctgccttatgtgtcgcccaagttgatgacctgcaagaat
ctggaactggccgtaccgggctcctataatcccggccaggagctaatacgcatcaatcac
atcaagaccaatctgcaggtgatcacgtccaaacagcgaccgcgcaaactatgcatacgt
ggctccaacggcaaggactatatgtacttgctgaagggtcacgaggatctgcggcaggat
gagcgcgtcatgcagctcttctcgctggtcaatacgctcctgctcgacgatcccgatacg
tttcgtcgcaatctggccatccagcgctatgccgtcataccgcttagcaccaactccgga
ctgattggctgggtgccgcactgtgatacgctgcacacgctcatccgggactatcgcgaa
aagaagaaggtgccgctgaatcaggagcatcgcaccatgctgaactatgcgcccgactat
gatcatctgacgctcatgcaaaaggtagaggtgttcgaatatgctctgggccagacccaa
ggcgatgatctggccaaattgttgtggttgaagtcaccctcgtcggagctgtggttcgag
cggcgcaacaattacacacgctcactggcggtcatgtccatggtgggctatatactcggc
ctgggtgatcgtcatccctcaaatctgatgttggatcgcatgagtggcaagatactgcat
attgattttggcgattgtttcgaggtggcgatgacgcgtgaaaagtttcccgagaagata
ccgttccggctgacacgaatgctcatcaaggccatggaggtcaccggcattgagggcacc
tatcggcgcacctgcgagagcgttatgctggtgctgcgtcgcaacaaggattcgctaatg
gccgtactggaagcattcgtgtacgatccgctgctcaattggcgtctgctcgatgtggac
aagaaggccaatgatacaacagcaacaactgctgctggtgccagcggcggcagtccaagc
aactccattgagcaggagtcactgctgcagggcaatcccttagccaagtccaagacctac
gaggcacaacagctgcatgtgggctacaccaatgtggcggatgtgaccaacagcaaggcc
agcatggttatacagcgtgtcaatcggaagctaaccggcacagatttccaaatgaccgag
atgacggagcagcagcaggtggagctgctcatacagcaggcgacaaacaatgagaacctc
tgccagtgttatattggctggtgtcccttctggtaa

DBGET integrated database retrieval system