KEGG   Drosophila virilis: Dvir_GJ16861Help
Entry
Dvir_GJ16861      CDS       T01066                                 

Definition
GJ16861 gene product from transcript GJ16861-RA
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
dvi  Drosophila virilis
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:dvi00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 604 aa AA seqDB search
MTALLLMPSAPVAQSPFESQSESQGLSDTKLHEVYLDDKEIKLSWMVDWYKQEVLFHLQN
AFNEQHRWFYLGFSKRGGLADADICFFENQNGFFNVVTDTYTSPDGHWVRKDYQQDCEVF
KMDEFTLAFKRKFDTCDPLDLRLHEGTMYVVWARGESELALEDHQFALPNVSAPHEAGLK
MLQLLRADKILIPETDLEHIEITLEQAPVPKQETTYWCHVQRLDDIIKNRLHIVQFEPII
KTPGIIHHMEVFHCETDAHVEIPLYNGDCEQLPLEAKVCSKVMSLWAMGASTFTYPPEAG
LPVGGPDFNPYVRLEVHFNNPELQAGLVDSSGFRIKVSKTLRQYDAGVMELGLEYTDKMA
IPPGQTAFPLSGYCVADCTRAALPRTGIIIFGSQLHTHLRGVRILTRHFRGEQELREVNR
DDYYSHHFQEIRTLHYKPRVLPGDALVTTCYYNTLADTNATLGGFSISDEMCVNYIHYYP
ATKLEVCKSSVSEETLEDYFIYMKRKEHQHGIHLNGARSANYRTIEWTKPHVDQLYTMYI
QEPLSMQCNRSDGQRFEGHNWEGVPPTPVQIKMPIHRKLCPNYNPLWLKPLEKGECDLLG
ECIY
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgctgctgctgatgcccagtgccccagtcgcccagtctccgttcgagtcgcag
tcggagtcgcagggtctctcggatacgaagctacatgaagtctatttggatgacaaggag
atcaagcttagctggatggtggattggtacaagcaggaggtgcttttccatttgcagaat
gcattcaatgagcagcatcgttggttctatttgggcttctcaaagcgcggcggattagcc
gatgcggatatttgtttctttgagaatcagaacggtttcttcaatgtggtcaccgacacg
tacaccagcccagatggccattgggtgcgcaaggactaccagcaggactgcgaggtcttc
aaaatggatgagtttacgctggccttcaagcgcaagtttgatacctgcgatccgctcgat
ctgcgactgcacgagggaaccatgtatgtggtctgggcacgcggcgaatcggagcttgcc
ttagaggatcatcagtttgcgttgcccaatgtgagtgcaccacatgaggcgggtctcaag
atgctgcagctgctgcgcgccgacaagatactcatacccgaaaccgatttggagcatatt
gaaatcacgctggagcaggcgccggtgcccaagcaggagaccacctactggtgtcatgtt
caacgtttggatgacataatcaagaatcgtttgcatattgtacaatttgagccgattatc
aagacgccgggcattatacatcacatggaggtgttccactgcgaaacggacgcacacgtt
gagattccactgtacaatggcgactgcgaacagctgccgttggaggccaaggtctgctcc
aaggtaatgtcattgtgggccatgggtgccagcacttttacatatccacctgaggctggc
ctgccagtcggtggacccgattttaatccctacgttcgactcgaggtgcacttcaataat
ccggagctgcaggcgggtctggtggatagctctggatttcgcatcaaagtatcaaagaca
ctgcggcaatacgatgccggcgtcatggaattgggtctggaatatactgacaaaatggcc
ataccgcccggccagacggcgttcccactgagtggctactgtgtggccgattgtacacgg
gccgcactgccacggacgggcatcatcatctttggttcgcagctgcatacacatttgcga
ggggttcgcatcctaacacgacattttcgcggcgaacaggagctgcgcgaggtgaatcgc
gatgattactattcgcatcatttccaggaaatacgcacactgcactacaagccgcgtgtg
ttgccgggcgacgctctggtcacaacgtgctattataatacgcttgccgatacgaatgcc
acgctgggcggcttttccattagcgatgagatgtgcgtcaactatatacattactatccg
gctaccaagttggaggtgtgcaagagttccgtttcggaggagacgctcgaggattacttt
atctacatgaagcgcaaggagcatcagcatggcatacacttgaacggggcacgttctgcg
aattatcggactatcgaatggacaaagccgcacgttgaccaattgtatacgatgtacatc
caggagccgcttagcatgcaatgcaacagatccgatggccagcgtttcgagggacacaac
tgggagggtgtgccgccgacgccagtgcaaatcaaaatgcccatccatcggaaattgtgc
cccaactacaatccactgtggctgaagccgttggagaagggtgaatgcgatttgctgggc
gagtgcatctactag

DBGET integrated database retrieval system