KEGG   Drosophila virilis: Dvir_GJ16861Help
Entry
Dvir_GJ16861      CDS       T01066                                 

Definition
GJ16861 gene product from transcript GJ16861-RA
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
dvi  Drosophila virilis
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dvir_GJ16861
Enzymes [BR:dvi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     Dvir_GJ16861
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 604 aa AA seqDB search
MTALLLMPSAPVAQSPFESQSESQGLSDTKLHEVYLDDKEIKLSWMVDWYKQEVLFHLQN
AFNEQHRWFYLGFSKRGGLADADICFFENQNGFFNVVTDTYTSPDGHWVRKDYQQDCEVF
KMDEFTLAFKRKFDTCDPLDLRLHEGTMYVVWARGESELALEDHQFALPNVSAPHEAGLK
MLQLLRADKILIPETDLEHIEITLEQAPVPKQETTYWCHVQRLDDIIKNRLHIVQFEPII
KTPGIIHHMEVFHCETDAHVEIPLYNGDCEQLPLEAKVCSKVMSLWAMGASTFTYPPEAG
LPVGGPDFNPYVRLEVHFNNPELQAGLVDSSGFRIKVSKTLRQYDAGVMELGLEYTDKMA
IPPGQTAFPLSGYCVADCTRAALPRTGIIIFGSQLHTHLRGVRILTRHFRGEQELREVNR
DDYYSHHFQEIRTLHYKPRVLPGDALVTTCYYNTLADTNATLGGFSISDEMCVNYIHYYP
ATKLEVCKSSVSEETLEDYFIYMKRKEHQHGIHLNGARSANYRTIEWTKPHVDQLYTMYI
QEPLSMQCNRSDGQRFEGHNWEGVPPTPVQIKMPIHRKLCPNYNPLWLKPLEKGECDLLG
ECIY
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgctgctgctgatgcccagtgccccagtcgcccagtctccgttcgagtcgcag
tcggagtcgcagggtctctcggatacgaagctacatgaagtctatttggatgacaaggag
atcaagcttagctggatggtggattggtacaagcaggaggtgcttttccatttgcagaat
gcattcaatgagcagcatcgttggttctatttgggcttctcaaagcgcggcggattagcc
gatgcggatatttgtttctttgagaatcagaacggtttcttcaatgtggtcaccgacacg
tacaccagcccagatggccattgggtgcgcaaggactaccagcaggactgcgaggtcttc
aaaatggatgagtttacgctggccttcaagcgcaagtttgatacctgcgatccgctcgat
ctgcgactgcacgagggaaccatgtatgtggtctgggcacgcggcgaatcggagcttgcc
ttagaggatcatcagtttgcgttgcccaatgtgagtgcaccacatgaggcgggtctcaag
atgctgcagctgctgcgcgccgacaagatactcatacccgaaaccgatttggagcatatt
gaaatcacgctggagcaggcgccggtgcccaagcaggagaccacctactggtgtcatgtt
caacgtttggatgacataatcaagaatcgtttgcatattgtacaatttgagccgattatc
aagacgccgggcattatacatcacatggaggtgttccactgcgaaacggacgcacacgtt
gagattccactgtacaatggcgactgcgaacagctgccgttggaggccaaggtctgctcc
aaggtaatgtcattgtgggccatgggtgccagcacttttacatatccacctgaggctggc
ctgccagtcggtggacccgattttaatccctacgttcgactcgaggtgcacttcaataat
ccggagctgcaggcgggtctggtggatagctctggatttcgcatcaaagtatcaaagaca
ctgcggcaatacgatgccggcgtcatggaattgggtctggaatatactgacaaaatggcc
ataccgcccggccagacggcgttcccactgagtggctactgtgtggccgattgtacacgg
gccgcactgccacggacgggcatcatcatctttggttcgcagctgcatacacatttgcga
ggggttcgcatcctaacacgacattttcgcggcgaacaggagctgcgcgaggtgaatcgc
gatgattactattcgcatcatttccaggaaatacgcacactgcactacaagccgcgtgtg
ttgccgggcgacgctctggtcacaacgtgctattataatacgcttgccgatacgaatgcc
acgctgggcggcttttccattagcgatgagatgtgcgtcaactatatacattactatccg
gctaccaagttggaggtgtgcaagagttccgtttcggaggagacgctcgaggattacttt
atctacatgaagcgcaaggagcatcagcatggcatacacttgaacggggcacgttctgcg
aattatcggactatcgaatggacaaagccgcacgttgaccaattgtatacgatgtacatc
caggagccgcttagcatgcaatgcaacagatccgatggccagcgtttcgagggacacaac
tgggagggtgtgccgccgacgccagtgcaaatcaaaatgcccatccatcggaaattgtgc
cccaactacaatccactgtggctgaagccgttggagaagggtgaatgcgatttgctgggc
gagtgcatctactag

DBGET integrated database retrieval system