KEGG   Drosophila virilis: Dvir_GJ17211Help
Entry
Dvir_GJ17211      CDS       T01066                                 

Definition
GJ17211 gene product from transcript GJ17211-RA
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dvir_GJ17211
Peptidases [BR:dvi01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Dvir_GJ17211
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 229 aa AA seqDB search
MSIWTPLESNPEVLTKYIHKLGVSSAWSVTDVIGLDEELLAMLPRPVKSLILLFPISEAY
EKHRAEEHERIKAAAEPEKYPKDLFYMKQFTHNACGTVALIHSVANNKDIEIAAGVLKNF
LEKGANLSPEERGQALEQDNAFTEDHQMLAQEGQTDAGAYETVVHHFIALVNKENTLYEL
DGRKSYPISHGKTSDETFVLDAAKVCKEFMARDPDDVRFTVLALAATQE
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatctggacaccattggaatccaacccggaggtgctgaccaaatacatacataag
ctgggcgtgtcgtcggcctggtctgtgactgacgtcatcggcctggacgaagaactgctg
gcaatgctgccgcgtcccgtgaagtccctcatcttgctcttccccattagcgaggcttat
gaaaaacatcgcgctgaagagcacgagcgcatcaaggctgctgctgagccggaaaaatat
ccaaaagatctcttttacatgaaacagttcacccacaacgcctgcggcaccgttgccctc
atccacagtgtggccaataataaggacatcgaaatagccgccggcgttttgaagaatttc
ttggagaagggcgccaacctatcgcccgaggaacgcggccaggctctagagcaggacaac
gcctttaccgaagaccatcagatgctggcccaagagggacaaaccgatgccggtgcctat
gaaaccgttgttcaccatttcattgcactggtcaacaaggagaatactctgtacgagcta
gacggacgcaagtcgtacccaatcagtcatggcaagacctcggatgagacttttgtgcta
gatgctgccaaggtgtgcaaggagttcatggcacgcgatcccgacgatgtgcgtttcacc
gtgctggctctggctgccacacaggaatag

DBGET integrated database retrieval system