KEGG   Drosophila virilis: Dvir_GJ17308Help
Entry
Dvir_GJ17308      CDS       T01066                                 

Definition
(RefSeq) GJ17308 gene product from transcript GJ17308-RA (EC:2.4.1.-)
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dvi  Drosophila virilis
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dvir_GJ17308
   00053 Ascorbate and aldarate metabolism
    Dvir_GJ17308
   00500 Starch and sucrose metabolism
    Dvir_GJ17308
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dvir_GJ17308
   00860 Porphyrin and chlorophyll metabolism
    Dvir_GJ17308
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dvir_GJ17308
   00982 Drug metabolism - cytochrome P450
    Dvir_GJ17308
   00983 Drug metabolism - other enzymes
    Dvir_GJ17308
Enzymes [BR:dvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dvir_GJ17308
Glycosyltransferases [BR:dvi01003]
 Others
  Hydrophobic molecule
   Dvir_GJ17308
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 537 aa AA seqDB search
MRMVRGNVLLMILAPLLVLPDSRVNGANILGMFSTFSPSHLIVHMSMMRALADRGHNVTI
VTALKPKLVPHENITYILAPLSEHHLAFVNEYMANSAKEKHSMAMTFLKTIIGTGQLMDS
QYEFLLHPNVRALHEQPQVKFDLMILGYVFNDYQLGVAAKLGIPAIISWVGVPFSFVDDE
VGNIYDPAYVPNVNVVQDKRLRTMGFGLRLRNYLSWLLLKGIGLALDVRMNNYYTRVFGE
DPALPSYQDVKRRVSLLFYNYHSHSEGPVRPTVPQSIEIGGVQIKEQPDPLPKELAEFMA
NATEGAIFFSLGTNVKSSYFKPHIMEAIFQVLARQPLHVIWKCDDLQHKPGHAANIYFHN
WLPQDDILAHPNTKLFITHAGKGGIAEAQYHGVPMLALPVFGDQPGNAELMVSAGFGLSL
DLLTLTEDRLEQSIRELLHNPAYRQNVRKFSQLYRDRPLTARQSVVYWTEYVMRHNGAYH
LQSPWLHMDFVARHNLDVYACLLLALAVSLFVFALLLRFTLKQLRRLARSKDKVKEN
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgaggatggtccgaggcaacgtgctcttgatgattctggcgccgctgctggtgcttcca
gattcacgtgtgaatggcgccaacattttgggcatgttcagcacatttagtccatcgcat
ttgatagtgcacatgtcaatgatgcgggcgctggcggatcgtggacacaatgtgaccatt
gtgacggctttgaagcccaagctcgtgccgcatgagaatataacatatatcctggcgccg
ctcagtgaacatcatctggccttcgtgaacgagtacatggcgaactcggccaaggagaag
cattcaatggctatgacatttctcaagacaataataggaacaggtcaattgatggacagt
cagtatgagttcctgttacatcccaatgtgcgggcacttcacgagcagccgcaggtgaag
ttcgatttgatgatcttgggctatgtgttcaatgattaccaattgggcgtggcagccaag
ttgggcatacccgcgattataagctgggtgggcgtgccattttcatttgtcgacgacgag
gtgggcaacatctacgatcccgcgtatgtgcccaacgtgaatgtggttcaggacaagcgc
ctccgtaccatgggcttcggtctgcgactgcgcaactaccttagctggctgttgctcaaa
ggtataggcctggcactggatgtacgcatgaacaactattacacacgcgtttttggcgag
gatcctgctctgcccagctaccaagatgtgaagcgtcgcgtctcgctgctcttctacaat
tatcactcgcatagcgagggtcctgtacgtcccacggtgccgcagtccattgaaattggt
ggcgtgcagatcaaggagcagccggatccattgcctaaagagctggctgaatttatggcc
aatgccacagagggtgccatcttctttagcctgggcaccaatgttaagagctcctacttc
aagccacacatcatggaggctatcttccaggtgctcgcgcgccagccgctgcacgtcatc
tggaaatgtgatgatctgcagcataagccgggccatgctgcaaatatatactttcacaac
tggctgccacaggacgacatcctggcccatccaaacaccaagctcttcatcacgcacgcc
ggcaagggtggcattgcggaggcccagtaccacggtgtgcccatgctggcgctgcccgtg
tttggtgatcagcctggcaatgcagagctaatggtatccgccggcttcggactgagtctg
gatctgctcacgctaaccgaggatagactggagcagagcatacgcgagctgctgcacaat
cctgcatatcgccagaatgtccgcaaattttcccagctctatcgcgatcgtccgctcacc
gctcgtcagtctgtcgtctattggacggagtacgtaatgcggcacaatggtgcctaccac
ctgcagagtccctggctgcacatggactttgtggcacgccacaatctcgatgtgtatgcc
tgcctcctacttgctcttgccgtctctttgtttgtttttgcgctgttgctgcgcttcact
ttgaagcagctgcggcgattggcacgctcaaaagacaaggtcaaagagaattag

DBGET integrated database retrieval system