KEGG   Drosophila virilis: Dvir_GJ17311Help
Entry
Dvir_GJ17311      CDS       T01066                                 

Definition
(RefSeq) GJ17311 gene product from transcript GJ17311-RC
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dvi  Drosophila virilis
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dvir_GJ17311
   00053 Ascorbate and aldarate metabolism
    Dvir_GJ17311
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dvir_GJ17311
   00860 Porphyrin and chlorophyll metabolism
    Dvir_GJ17311
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dvir_GJ17311
   00982 Drug metabolism - cytochrome P450
    Dvir_GJ17311
   00983 Drug metabolism - other enzymes
    Dvir_GJ17311
Enzymes [BR:dvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dvir_GJ17311
Glycosyltransferases [BR:dvi01003]
 Others
  Hydrophobic molecule
   Dvir_GJ17311
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 545 aa AA seqDB search
MAHQGRSFLTGTFACLLLGFFVIQSPAVEGANILGVFTSHSPSHLIIHMSIMKALAEEGH
NVTVVSTTQPKVTHKSIKHIVIPLSAAEEKVISDGMTAMAKEKPSMITTMKSLFGSLSML
IYKQVDVLEDKRFTDLYKNKDNKFDAVVVGFFFNFFQVGLGARFNCPLILSWTGAPMVQI
DDAVGNPELVATVPSMNVAVLPGHAMDFKQRLANFGSSIFFRLLGFYLDILNVQFYDRLW
GKDPSMISYEEAKKNVSLAFCNSHAISEGPIRPNVPAVIEIGGIQIKNKPDPLPQDIKEF
LDNAKHGAILFSLGSNLKGDHIQPELIGKIFEALSSLKQNVIWKWDDLKNLPGKSSNILY
KKWLPQDDILAHPSIKLFITHAGKGGVAESQYHGKPMLALPVFADQPGNADKLVQAGYGL
RIDLFTLEVDEFKGAIKEILKNPSYKTKVQQFSKLYRDRPMSARDSVIYWVNYVLRHHGA
GHMQSPLVHMNFIARHNLDVYLLLTTILIVIALISTVVLKFCWRKCCGGKGKSQKTGQKA
KVKKN
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaccagggtagatcttttctgaccggcacttttgcttgcctgttgctcggattc
tttgtgatccaatcgccggctgttgagggcgctaatatattgggcgtgttcaccagccac
agtccatcgcatctgataatccacatgtccatcatgaaggcgctggccgaggagggtcac
aatgtgacagtggtgtcaaccacacagccaaaggtgacacacaagagcatcaaacacatt
gtgatacctctgagcgcggccgaggagaaggtcataagcgatggcatgaccgcaatggca
aaggagaagccctcaatgattactacgatgaaaagtttatttggctcgctctcgatgctt
atttacaagcaagtcgacgtgctggaggacaaacgcttcaccgatctctacaagaacaaa
gacaacaaattcgatgctgttgtcgtgggtttcttcttcaacttctttcaggtgggcctt
ggtgccagatttaattgccccttgattttgagctggaccggagcgcccatggtgcaaatc
gatgatgctgttggcaatccagaactggtcgccacagtgcccagcatgaatgtagctgta
ctgcctggccacgccatggactttaagcagcgtctggccaattttggtagctccatattc
ttccgcctcttgggtttctatctggatatattaaatgtgcagttttacgatcgcctttgg
ggcaaggatccgtccatgataagctatgaggaggccaagaagaacgtatctctggcgttc
tgcaatagtcatgccatcagcgagggacctatcagacccaacgtgcctgcagttattgag
attggtggcatacagattaagaataagcccgatcccttgccacaggacataaaggagttc
ttggacaatgcgaagcatggcgcaattctcttcagcctgggcagcaatctcaagggcgat
cacattcaaccagaactcattggcaaaatattcgaagcgctctccagccttaaacagaat
gtgatctggaagtgggatgatcttaagaacttgcccggaaaatcgtctaatattctctat
aaaaagtggctgccacaggacgacatactcgcccatcccagcattaagctgtttataacg
cacgctggaaaaggaggcgtggccgagtctcagtaccatggcaagcccatgctggcgctg
cctgtatttgccgatcagcctggaaatgcagataagctggttcaggctggctacggccta
cgcatcgatttgttcaccctggaggtggatgagtttaagggtgccatcaaggagatactc
aagaatccgagctacaaaaccaaggttcaacagttttccaaactctatcgcgatcgtcct
atgtcggcacgcgattcggtgatctactgggttaactatgtactccgtcatcatggcgcc
ggccacatgcaaagtccccttgtccatatgaactttattgcgaggcacaatctagacgtc
tatctattgcttacaacgattcttattgttatcgccttaataagcacagttgtgctcaag
ttctgctggaggaaatgttgtggcggcaaaggcaagtcgcaaaagactggccaaaaggca
aaggtcaagaagaactag

DBGET integrated database retrieval system