KEGG   Drosophila virilis: Dvir_GJ17455Help
Entry
Dvir_GJ17455      CDS       T01066                                 

Definition
GJ17455 gene product from transcript GJ17455-RA
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
dvi  Drosophila virilis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dvir_GJ17455
Enzymes [BR:dvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dvir_GJ17455
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 438 aa AA seqDB search
MNIPYAHTAASILLLVSGSANAFYSPSDNVVELTPSNFNREVVQDNAIWVVEFYAPWCGH
CQSLVPEYKKLAEALKGVIKVGSVNADQHSELGGKYNVRGFPTIKIFGANKQSPTDYNGQ
RTAKAIAEAALAEAKKKVQAAFGGGDSSSKSRSSSSDSDVIELTEDNFDKLVLNSEDIWL
VEFFAPWCGHCKNLAPEWAKAAKELKGKVKLGALDATAHQSKAAEYNVRGYPTIKFFPAG
SKSSSDAEEYNGGRTASEIISWASDKHTENVPAPELVEITDESTFDSACEGKPLCVVSVL
PHILDCDAKCRNKFLDTLRILSEKFKQKLWGWAWAEGGQQPALEESLEVGGFGYPAMAVV
NFKKMKFSVLKGSFSKDGINEFLRDISYGRGHTSPVRGAKKPTIISVEPWDGKDGQLPTE
EDIDLSDIDLDDDVKDEL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcccatacgcccacacagctgcgagcattttgttgctcgtttccggcagcgcc
aacgcgttttattcaccttccgataacgttgtggagctgacaccatcgaacttcaatcgc
gaggttgtccaggacaacgccatatgggttgtcgaattctatgcgccttggtgcggacac
tgccagagcctggtgcccgaatacaagaagctggccgaagcgcttaaaggcgtaattaag
gtgggttcggtcaatgccgatcagcattccgaacttggtggtaaatataatgtacgtggc
tttcccacgatcaaaatcttcggcgccaataaacaatcgcctaccgattacaatggacaa
cgcacagctaaagcgattgcagaggccgctctggctgaggccaagaagaaggttcaggcc
gctttcggaggcggggacagcagcagcaagagccgctcttccagttccgatagtgatgtc
atcgaactaaccgaagacaactttgacaaacttgtgctgaattccgaagatatttggctg
gtggagttctttgcgccctggtgcggtcactgcaagaatcttgcgcctgagtgggccaag
gctgccaaggagttaaagggcaaggtcaagctgggcgctcttgacgcgacggcacatcaa
agcaaggcggccgagtataatgtacgtggctatccgaccatcaagttcttcccagccggc
tcgaaaagctccagcgatgctgaggaatacaatggtggtaggactgcctctgagataatc
agctgggctagcgataagcacacggagaatgtgccagcgccagagcttgtggagattacc
gatgaatcaactttcgacagtgcttgcgagggcaaacccttgtgcgtggtctctgtcctg
ccgcatattctagactgcgacgccaagtgccgcaacaagttcctggacactttgcgcatc
ttgagcgagaagtttaagcaaaagctttggggttgggcctgggccgaaggcggtcaacag
ccagctctggaggagtctttggaagttggtggtttcgggtatccagccatggcggttgtc
aactttaagaaaatgaagttttccgtgctaaaaggctccttctccaaggatggcataaat
gagttcctgcgcgacatatcctacggccgtggccatacgtcacccgtccgtggagccaag
aaaccaactatcatcagcgttgagccctgggacggcaaggacggacagctacctaccgag
gaagacatagatctgagcgacattgatctggacgatgatgtcaaggacgaactgtaa

DBGET integrated database retrieval system