KEGG   Drosophila virilis: Dvir_GJ17460Help
Entry
Dvir_GJ17460      CDS       T01066                                 

Definition
GJ17460 gene product from transcript GJ17460-RA
Orthology
K11252  
histone H2B
Organism
dvi  Drosophila virilis
Brite
Exosome [BR:dvi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dvir_GJ17460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKNDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgaaaacaagtgggaaggcagccaaaaaggctggtaaggctcagaaaaacatt
accaagaatgacaagaagaagaagcgcaagaggaaggaaagctacgctatctacatttac
aaagtgctcaagcaggtccaccctgacaccggcatttcgtcaaaggcgatgagcataatg
aacagctttgttaacgacattttcgagcgtattgctgccgaggcctcccgtttggctcac
tacaacaaacgctcgactattaccagtcgggaaatccaaaccgcagtacgtcttttgctg
cccggtgaattggccaagcacgctgtcagtgagggaacaaaagcagttacaaagtacacc
agctccaagtaa

DBGET integrated database retrieval system