KEGG   Drosophila virilis: Dvir_GJ17488Help
Entry
Dvir_GJ17488      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
dvi  Drosophila virilis
Pathway
dvi00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dvir_GJ17488
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Dvir_GJ17488
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-GeneID: 6628749
NCBI-ProteinID: XP_002052318
FlyBase: FBgn0204658
UniProt: B4LQL6
Position
Unknown
AA seq 409 aa AA seqDB search
MYKAAKVNFKSIILKIKLFGLTKFSSGKRKKSEMELDVLVFGSSNIDYITYVNELPRPGE
TLFGMYREQCYGGKGASQCVAAAKLGGRCALVSKLGQDKLGDDYFEYLRELGINVDFVDR
AEGKQTGLTEIIVADNTENAIIVMAGANECLKTPDVSRAKKVFKRAKVLICQLETDEKAA
LCALKQFKGESILNVSPVPKNMNVELIKAPTILCVNRLEAAQLTDREEIKTLQDAKAAAN
DLIDKGAKSVIITMGPLGAVHLSSKDREVCTQCPAAPVRFLADTSGAGEAFLGSLAYHMS
MFPNLSRESHISAANICAAYAVGHRGTQPSFPGPELFQADLCHASPEFNVIPDKAPTPEQ
SVSELPPGAADPPAPEEDPKPEPPMDQDESHEPNKIEEQEKNERESIPA
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtataaagctgctaaagtgaattttaagtcaattattttaaaaatcaaattatttggc
ctaacaaaattctcgagcggaaagcgcaagaaatccgaaatggagctggatgtgctagtg
tttggttcatcaaatatcgactacattacgtatgtcaatgagcttcccaggcccggggag
acgttgtttggcatgtacagggaacaatgctatggcggcaagggcgccagccaatgcgta
gcagctgcgaaactgggcgggagatgtgccctggtgtccaaattgggccaagataagctt
ggcgatgactacttcgagtatctgcgagaattagggatcaatgtggactttgtggatagg
gcagagggcaagcaaacgggcttgacggaaatcattgtggccgataatactgagaacgct
atcatcgtgatggccggtgccaacgaatgcctgaagacccccgatgtctcccgcgcaaag
aaggtgttcaagcgcgccaaggtactgatttgccaactggaaacggatgagaaggccgcc
ctctgcgcgctgaagcaatttaagggtgaatccattttgaatgtctcgccggtacccaaa
aatatgaacgtagagctgatcaaagcgccaactattttgtgcgtcaataggttggaggcg
gcacagctaacggaccgcgaggagatcaaaacactgcaggatgccaaggcggctgccaat
gatctgatagacaagggtgccaagagtgtcatcatcacgatgggaccactgggcgctgtt
catttgtcaagtaaggatcgggaagtctgcacccagtgtccggcagcgccagtgcgcttt
ttggccgacacttctggcgcgggtgaggcctttttgggcagtctggcctaccacatgtca
atgtttccaaatctgagccgggagagtcacatcagtgcggccaacatttgtgccgcctac
gctgttgggcatcgtggcactcagcccagctttccgggcccggaattgttccaggcggat
ctgtgccatgcgtcaccggagttcaatgtgatacccgacaaggctccaacgccggagcaa
tctgtatcagagcttccgccaggagccgcagacccacccgccccagaagaagaccctaag
ccggagccaccaatggaccaggatgaatcacatgaaccaaataaaatcgaagagcaagaa
aaaaacgaacgggaatcaattccagcatga

DBGET integrated database retrieval system