KEGG   Drosophila virilis: Dvir_GJ17488Help
Entry
Dvir_GJ17488      CDS       T01066                                 

Definition
GJ17488 gene product from transcript GJ17488-RA
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dvi  Drosophila virilis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dvir_GJ17488
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Dvir_GJ17488
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 376 aa AA seqDB search
MELDVLVFGSSNIDYITYVNELPRPGETLFGMYREQCYGGKGASQCVAAAKLGGRCALVS
KLGQDKLGDDYFEYLRELGINVDFVDRAEGKQTGLTEIIVADNTENAIIVMAGANECLKT
PDVSRAKKVFKRAKVLICQLETDEKAALCALKQFKGESILNVSPVPKNMNVELIKAPTIL
CVNRLEAAQLTDREEIKTLQDAKAAANDLIDKGAKSVIITMGPLGAVHLSSKDREVCTQC
PAAPVRFLADTSGAGEAFLGSLAYHMSMFPNLSRESHISAANICAAYAVGHRGTQPSFPG
PELFQADLCHASPEFNVIPDKAPTPEQSVSELPPGAADPPAPEEDPKPEPPMDQDESHEP
NKIEEQEKNERESIPA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggagctggatgtgctagtgtttggttcatcaaatatcgactacattacgtatgtcaat
gagcttcccaggcccggggagacgttgtttggcatgtacagggaacaatgctatggcggc
aagggcgccagccaatgcgtagcagctgcgaaactgggcgggagatgtgccctggtgtcc
aaattgggccaagataagcttggcgatgactacttcgagtatctgcgagaattagggatc
aatgtggactttgtggatagggcagagggcaagcaaacgggcttgacggaaatcattgtg
gccgataatactgagaacgctatcatcgtgatggccggtgccaacgaatgcctgaagacc
cccgatgtctcccgcgcaaagaaggtgttcaagcgcgccaaggtactgatttgccaactg
gaaacggatgagaaggccgccctctgcgcgctgaagcaatttaagggtgaatccattttg
aatgtctcgccggtacccaaaaatatgaacgtagagctgatcaaagcgccaactattttg
tgcgtcaataggttggaggcggcacagctaacggaccgcgaggagatcaaaacactgcag
gatgccaaggcggctgccaatgatctgatagacaagggtgccaagagtgtcatcatcacg
atgggaccactgggcgctgttcatttgtcaagtaaggatcgggaagtctgcacccagtgt
ccggcagcgccagtgcgctttttggccgacacttctggcgcgggtgaggcctttttgggc
agtctggcctaccacatgtcaatgtttccaaatctgagccgggagagtcacatcagtgcg
gccaacatttgtgccgcctacgctgttgggcatcgtggcactcagcccagctttccgggc
ccggaattgttccaggcggatctgtgccatgcgtcaccggagttcaatgtgatacccgac
aaggctccaacgccggagcaatctgtatcagagcttccgccaggagccgcagacccaccc
gccccagaagaagaccctaagccggagccaccaatggaccaggatgaatcacatgaacca
aataaaatcgaagagcaagaaaaaaacgaacgggaatcaattccagcatga

DBGET integrated database retrieval system