KEGG   Drosophila virilis: Dvir_GJ17518Help
Entry
Dvir_GJ17518      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
dvi  Drosophila virilis
Pathway
dvi04013  MAPK signaling pathway - fly
dvi04068  FoxO signaling pathway
dvi04140  Autophagy - animal
dvi04150  mTOR signaling pathway
dvi04214  Apoptosis - fly
dvi04320  Dorso-ventral axis formation
dvi04350  TGF-beta signaling pathway
dvi04933  AGE-RAGE signaling pathway in diabetic complications
Module
dvi_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dvir_GJ17518
   04350 TGF-beta signaling pathway
    Dvir_GJ17518
   04068 FoxO signaling pathway
    Dvir_GJ17518
   04150 mTOR signaling pathway
    Dvir_GJ17518
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    Dvir_GJ17518
  Cell growth and death
   04214 Apoptosis - fly
    Dvir_GJ17518
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dvir_GJ17518
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dvir_GJ17518
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dvir_GJ17518
Protein kinases [BR:dvi01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   Dvir_GJ17518
Chromosome [BR:dvi03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     Dvir_GJ17518
Exosome [BR:dvi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dvir_GJ17518
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Haspin_kinase YukC Choline_kinase FTA2 Kinase-like
Motif
Other DBs
NCBI-GeneID: 6629054
NCBI-ProteinID: XP_002052382
FlyBase: FBgn0204688
UniProt: B4LQZ8
Position
Unknown
AA seq 375 aa AA seqDB search
MAEGNTGTSAEGAAALAAPHPNAEVIRGQIFEVGPRYRKLTYIGEGAYGMVVSADDTLTN
QRVAIKKISPFEHQTYCQRTLREITILTRFKHENIIDIRDILRVDSIEQMRDVYIVQCLM
ETDLYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICDF
GLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIF
PGKHYLDQLNHILGVLGSPSQEDLECIINEKARNYLESLPFKPNVPWSRLFPNADALALD
LLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAEVPFRINMENDDISRDALKSLIF
EETLKFKERQPEQAL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggcggagggaaatactggaactagtgctgagggtgctgccgccttggctgccccacat
cctaacgccgaagttataagggggcaaatatttgaagtcggcccaagatataggaaattg
acatatatcggtgaaggcgcatatggcatggtggtatctgctgatgacacgttgacgaac
caaagagttgctattaaaaaaatttctccgtttgagcaccagacgtattgtcaacgaact
ctaagggagataaccattttaaccagatttaaacacgaaaatattattgatatacgcgac
atcttgcgagtagatagcatagaacaaatgagggatgtatatattgtacaatgcttaatg
gagactgatctgtataaactacttaaaacgcagaggctgagtaacgatcacatctgttac
tttctgtatcaaatattgcgtggtttaaagtatatccattcggcaaacgttttacatcga
gacctaaagccgagcaatcttttgctaaataagacatgcgatttaaaaatttgtgacttt
ggtttagcccgtattgctgacccagagcacgaccacactggtttccttacagaatatgta
gcaactaggtggtaccgggcaccggaaataatgcttaattcaaaagggtatacaaaatca
attgatatctggtcagttgggtgcattttggctgaaatgctaagcaaccgacccatcttt
cctggaaaacattatttagatcaactcaaccatattcttggcgtgctaggatccccatca
caggaagacttagaatgtattattaatgaaaaggcacggaattatttagaatctttgcct
tttaagccaaatgtgccatggtcgaggttattccccaatgcagacgctttggcgttggat
ttacttggtaagatgctgacgttcaacccgcacaaacgaattccagtagaggaagctctt
gcacatccatatttagagcagtattatgatcctggcgatgagcctgttgcagaagtacca
tttcgcattaatatggaaaatgatgatatatctagagacgctttgaaatcgttaattttt
gaagaaacgttaaaatttaaagaacgacaaccagaacaggctctataa

DBGET integrated database retrieval system