KEGG   Drosophila virilis: Dvir_GJ17519Help
Entry
Dvir_GJ17519      CDS       T01066                                 

Definition
(RefSeq) GJ17519 gene product from transcript GJ17519-RA (EC:3.4.19.12)
  KO
K08601  
ubiquitin thioesterase [EC:3.4.19.12]
Organism
dvi  Drosophila virilis
Pathway
MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dvir_GJ17519
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dvir_GJ17519
Peptidases [BR:dvi01002]
 Cysteine Peptidases
  Family C67
   Dvir_GJ17519
Ubiquitin system [BR:dvi04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dvir_GJ17519
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 965 aa AA seqDB search
METKPKYSKYALVNRQIELTKSGCISSSDVDCNVNVNNTNTRTDKLMVLPGSSIKIIGTP
DGKESEKCIVQILDFNTYTNTQFYEIKSSYLVRVADDIWPFVISIANLESRLRLVCNKEQ
CLWLTTLKLNDLVSVQGELFKKGNLCFDCIVRYIGPVEELNPVGYFFGLEILHLNSGHSP
QAKDIPFATKYLNCEPHLSIFATADWIAPVSSELKHKLSAKKFMNDTIERVYTAILPANL
NLHAQRSDNKYKKRQPTAQFYDSLPGNSTDKPEGEIMTESIKTDERMPINEVNKCNNKEL
KTYLSNFPASSERKSTNQAKSATSLRKNIASEKDLFGIKNRTESSINERDIIIINKSDIE
ESTKNEHNVFIVNNPQEKENVDLADLLGTNWPTNAGGAGMMLNRTQSVAKTSDNKLEACP
SSSLTCESFSKNNEKCTDLSTSPLDVKSNLEINNSNYQQLSEIPGTKLTIGSLVEVSDSG
PSDFYGVIRWIGIPPNSTNIMVGIEVEDDPNLRNLSTSDGTYNGVRLFKCREGGAIFVPS
NKCASDHRFVDTEGSCLVGTISPDVNGIKFGHVDCPSVLGAVPPLGVQNVDELEEICGKF
KGIQGHHNSCYLDATLFSMFTFTSVFDSILYRRPDPQDISHYRAVQNVLRDEIVNPLRKN
VFVRADRVMKLRKFLDQLSSVSGLTSEEKDPEEFLNSLLSQIMKVEPFLKLSSGQDSYFY
QLFVEKDERLTFPTVQQLFEQSFHSSDIKLKEVPSCLIIQMPRFGKSYKMYPRILPSQFL
DITDIIEDSPRQCTVCGKLAEYECRECFGCLQAGSGLDYTAFCQKCLNTVHMHAKRANHK
SKKLSVPRDFKVMADHMILPRLYMDLFAVVCIETSHYVAFVKAGSGPDAPWCFFDSMADR
KGEKNGYNIPEMISVRELPKWLSDEGARHINERSVKDKDLPEHAKRLFCDAYMCMYQSTD
VMMYH
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggaaactaaaccaaaatattccaaatatgcgctcgtaaatcgtcagattgagcttacc
aaatctggatgtatttcttcttcagacgttgactgcaatgttaacgttaacaataccaat
acacgcactgacaagctaatggtgttgcctgggtcatcaataaagattattgggacacca
gacggtaaagaaagtgagaaatgtattgttcagatcttagatttcaatacttatacaaat
acgcaattttacgaaatcaagtcaagctatttggtaagagtagcagacgacatttggcca
tttgtcatcagcattgcaaatctggaaagtcgattgcgtctggtgtgcaataaggagcaa
tgcctctggttgactactttgaagctgaacgatctggtcagtgtgcaaggcgaattgttt
aaaaagggcaatttgtgttttgattgtattgtgcgttacattggtccagtggaggaactg
aatcccgtaggatacttttttggattggaaattttgcatctgaatagtggacactcgccg
caggccaaggacattccattcgcaacaaaatatttgaattgcgaaccccatttatcaata
tttgccactgcggattggatagctcccgtctcaagtgaacttaaacataaattatctgca
aaaaagttcatgaatgatactattgaacgagtgtacactgccatattgccggcaaacttg
aatcttcatgctcagcgaagcgataacaagtacaagaaacgacagcccacggctcagttt
tatgatagtttgccaggcaatagcacagataaaccggaaggcgaaattatgaccgagtct
atcaaaactgatgaaaggatgcccataaacgaagtaaataaatgtaataataaggaactt
aaaacatatttaagcaattttccggcatcttcggagcgaaagagcacaaatcaagcaaaa
agtgcgacaagccttcgtaaaaatattgctagcgaaaaagatctatttggtataaaaaat
agaacggaatcaagcattaatgaaagggatattataatcataaataaaagtgacattgaa
gagtccactaagaatgagcataatgtattcattgttaataatcctcaggaaaaagaaaac
gtggacctagccgatttgctaggcacgaattggccaacaaatgctggaggagctggtatg
atgttaaaccgaacacaatcagtagcgaaaacttctgacaataaattggaagcatgtcca
tcatctagcttgacgtgtgaaagtttttccaaaaataatgaaaaatgtacggacctatct
acttcacctttagatgtcaaatcaaatcttgagataaacaattcaaattaccagcagtta
tcggaaatacctggcacaaagctaacaatcggatctctcgttgaggtttcggattctgga
cctagtgatttttatggtgtaattcgttggatcggcattcctccaaattcaacaaacata
atggttggcattgaagttgaagatgatccaaacttaaggaatctgagcacatctgatgga
acttataatggtgttcgattgtttaaatgtcgtgaaggtggagctatttttgtaccgtct
aataaatgtgcaagtgaccataggttcgtcgatacagagggcagctgtttagttggcacg
atatcacctgacgttaacggaataaaatttggccacgttgattgtccatcagtgttaggg
gccgttccaccattgggtgtgcaaaatgtagatgaattagaagagatatgcggaaaattt
aaaggcattcagggacaccacaattcttgctatttagacgcaacattgttctcaatgttt
acttttaccagtgtctttgattccattttatatagaaggccagaccctcaggatatttca
cattatagggctgttcaaaacgttttacgtgatgagatagttaatccattgcgaaagaat
gttttcgttcgtgctgatcgtgtcatgaaactgcgtaaatttttggatcaacttagttcc
gtaagtggtttgaccagcgaggaaaaagatccagaagagtttttaaacagtttgttatcc
caaataatgaaagtggaaccatttttaaaactaagctctggacaagattcttatttttat
caactgtttgtagagaaagatgagcgattgacatttccgacggtgcagcaacttttcgaa
caaagctttcattcgtccgatataaaattaaaagaagttccgtcatgtctcataattcaa
atgcctcgttttggaaagagctacaaaatgtatcctcgaattttaccatcccaatttctg
gatattacagatataattgaagattcaccccgtcagtgtaccgtttgtggaaaacttgca
gaatacgaatgccgcgaatgttttggttgtttgcaggccggctctggccttgattacaca
gccttttgtcagaaatgccttaacacagttcacatgcatgcaaaaagagccaaccacaaa
tctaaaaaactttctgtgccaagagactttaaagtaatggccgatcacatgattttacca
agactttacatggatctctttgccgttgtatgtatagaaacttcgcattatgtagcattc
gtgaaagcaggctcgggaccagatgctccatggtgcttttttgattcaatggctgataga
aaaggtgaaaaaaacggatataatataccagaaatgatatccgttcgagaattgcctaag
tggttatctgacgagggcgcccgacacattaatgaaaggtccgtgaaggacaaagactta
cctgaacacgcgaagcgtctgttttgcgacgcgtatatgtgtatgtaccaaagcactgat
gttatgatgtaccattaa

DBGET integrated database retrieval system