KEGG   Drosophila virilis: Dvir_GJ17519Help
Entry
Dvir_GJ17519      CDS       T01066                                 

Definition
GJ17519 gene product from transcript GJ17519-RA
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.1.2.15]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dvir_GJ17519
Peptidases [BR:dvi01002]
 Cysteine Peptidases
  Family C67
   Dvir_GJ17519
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 679 aa AA seqDB search
MPINEVNKCNNKELKTYLSNFPASSERKSTNQAKSATSLRKNIASEKDLFGIKNRTESSI
NERDIIIINKSDIEESTKNEHNVFIVNNPQEKENVDLADLLGTNWPTNAGGAGMMLNRTQ
SVAKTSDNKLEACPSSSLTCESFSKNNEKCTDLSTSPLDVKSNLEINNSNYQQLSEIPGT
KLTIGSLVEVSDSGPSDFYGVIRWIGIPPNSTNIMVGIEVEDDPNLRNLSTSDGTYNGVR
LFKCREGGAIFVPSNKCASDHRFVDTEGSCLVGTISPDVNGIKFGHVDCPSVLGAVPPLG
VQNVDELEEICGKFKGIQGHHNSCYLDATLFSMFTFTSVFDSILYRRPDPQDISHYRAVQ
NVLRDEIVNPLRKNVFVRADRVMKLRKFLDQLSSVSGLTSEEKDPEEFLNSLLSQIMKVE
PFLKLSSGQDSYFYQLFVEKDERLTFPTVQQLFEQSFHSSDIKLKEVPSCLIIQMPRFGK
SYKMYPRILPSQFLDITDIIEDSPRQCTVCGKLAEYECRECFGCLQAGSGLDYTAFCQKC
LNTVHMHAKRANHKSKKLSVPRDFKVMADHMILPRLYMDLFAVVCIETSHYVAFVKAGSG
PDAPWCFFDSMADRKGEKNGYNIPEMISVRELPKWLSDEGARHINERSVKDKDLPEHAKR
LFCDAYMCMYQSTDVMMYH
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgcccataaacgaagtaaataaatgtaataataaggaacttaaaacatatttaagcaat
tttccggcatcttcggagcgaaagagcacaaatcaagcaaaaagtgcgacaagccttcgt
aaaaatattgctagcgaaaaagatctatttggtataaaaaatagaacggaatcaagcatt
aatgaaagggatattataatcataaataaaagtgacattgaagagtccactaagaatgag
cataatgtattcattgttaataatcctcaggaaaaagaaaacgtggacctagccgatttg
ctaggcacgaattggccaacaaatgctggaggagctggtatgatgttaaaccgaacacaa
tcagtagcgaaaacttctgacaataaattggaagcatgtccatcatctagcttgacgtgt
gaaagtttttccaaaaataatgaaaaatgtacggacctatctacttcacctttagatgtc
aaatcaaatcttgagataaacaattcaaattaccagcagttatcggaaatacctggcaca
aagctaacaatcggatctctcgttgaggtttcggattctggacctagtgatttttatggt
gtaattcgttggatcggcattcctccaaattcaacaaacataatggttggcattgaagtt
gaagatgatccaaacttaaggaatctgagcacatctgatggaacttataatggtgttcga
ttgtttaaatgtcgtgaaggtggagctatttttgtaccgtctaataaatgtgcaagtgac
cataggttcgtcgatacagagggcagctgtttagttggcacgatatcacctgacgttaac
ggaataaaatttggccacgttgattgtccatcagtgttaggggccgttccaccattgggt
gtgcaaaatgtagatgaattagaagagatatgcggaaaatttaaaggcattcagggacac
cacaattcttgctatttagacgcaacattgttctcaatgtttacttttaccagtgtcttt
gattccattttatatagaaggccagaccctcaggatatttcacattatagggctgttcaa
aacgttttacgtgatgagatagttaatccattgcgaaagaatgttttcgttcgtgctgat
cgtgtcatgaaactgcgtaaatttttggatcaacttagttccgtaagtggtttgaccagc
gaggaaaaagatccagaagagtttttaaacagtttgttatcccaaataatgaaagtggaa
ccatttttaaaactaagctctggacaagattcttatttttatcaactgtttgtagagaaa
gatgagcgattgacatttccgacggtgcagcaacttttcgaacaaagctttcattcgtcc
gatataaaattaaaagaagttccgtcatgtctcataattcaaatgcctcgttttggaaag
agctacaaaatgtatcctcgaattttaccatcccaatttctggatattacagatataatt
gaagattcaccccgtcagtgtaccgtttgtggaaaacttgcagaatacgaatgccgcgaa
tgttttggttgtttgcaggccggctctggccttgattacacagccttttgtcagaaatgc
cttaacacagttcacatgcatgcaaaaagagccaaccacaaatctaaaaaactttctgtg
ccaagagactttaaagtaatggccgatcacatgattttaccaagactttacatggatctc
tttgccgttgtatgtatagaaacttcgcattatgtagcattcgtgaaagcaggctcggga
ccagatgctccatggtgcttttttgattcaatggctgatagaaaaggtgaaaaaaacgga
tataatataccagaaatgatatccgttcgagaattgcctaagtggttatctgacgagggc
gcccgacacattaatgaaaggtccgtgaaggacaaagacttacctgaacacgcgaagcgt
ctgttttgcgacgcgtatatgtgtatgtaccaaagcactgatgttatgatgtaccattaa

DBGET integrated database retrieval system