KEGG   Drosophila virilis: Dvir_GJ17660Help
Entry
Dvir_GJ17660      CDS       T01066                                 

Definition
GJ17660 gene product from transcript GJ17660-RA
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     Dvir_GJ17660
    1.3.1.94  polyprenol reductase
     Dvir_GJ17660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 323 aa AA seqDB search
MLLSLISSLEELIDQYKINLIQVIFIVFIVTIVLLGSLMTLVESHLPNCIRQSFRYGKHS
HKGETDALISHLEVPKAWFSHFYIFAFGWSLLALYFISSSILTQTAAPEYVLRFLDFMCG
GRTQRQVLVDSNTAFIGTVLLTVQCVRRFYETNFVQIFSKRSRMNLSHYAVGHLHYFGAI
ISLLGNTAGFVRGSKPAPFTLSNISLLQATYTLVFLFAWLQQYASNMLLVRLRRDAKTGA
VQTEAHLLPSGGWFNLISSPHMFFEVVMYYCLADLFTPISTWKLIFLWVASNQTINALLT
HQWYRENFKDYPKQRHAIIPWLL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgtcactgattagctccttggaggagctcattgatcagtacaagataaatctg
attcaagtgattttcatcgttttcattgtgaccatcgtcttgctgggcagtttaatgacc
ctggtggaatcgcatctgcccaactgcattcgtcagtcctttcgctatgggaagcacagt
cataagggcgaaacggacgcactgatcagtcatctggaggtgcccaaggcctggttcagt
catttctatatattcgcctttggctggtctctgctggcgctctatttcatcagcagttcc
atcctcacccagactgcggcgccggagtacgtgctacgctttctggacttcatgtgcggc
ggacgcacccagcgccaggtgctggtggattcgaacacagcgttcataggaactgtgctg
ctcaccgtgcagtgtgtccgtcgcttctacgagacgaatttcgtgcaaatcttctccaag
cgcagccggatgaatctctcgcattatgccgtgggacatctgcactattttggcgccatt
atctcgctgctgggcaatacggcaggctttgtgcgcggctcaaaaccggcgccgttcacc
ctgtccaatatcagcctgctgcaggcaacatatacgctcgtcttcctcttcgcctggctg
cagcagtatgccagcaatatgctgctggtgcggctgcgcagggatgccaagacgggcgcc
gtgcagacggaggcgcatctgctgcccagcggcggctggttcaatttgatctcctcgccg
cacatgttcttcgaggtggtcatgtactattgcctcgccgatctgtttacgcccatcagc
acgtggaagctgatctttctgtgggtggccagcaatcagacgatcaacgcgctgctcacc
catcaatggtacagggagaactttaaggactatcccaagcagcgacatgccatcataccc
tggctgctgtag

DBGET integrated database retrieval system