KEGG   Drosophila virilis: Dvir_GJ17684Help
Entry
Dvir_GJ17684      CDS       T01066                                 

Definition
GJ17684 gene product from transcript GJ17684-RA
Orthology
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     Dvir_GJ17684
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 773 aa AA seqDB search
MSHWYRNYAPSWIQRWWHPSPPAKPVNPFRSTRPGPDIANAASSAVLGVQRVDPCLADNH
VEHHTSHFYAAAAKEALIVRRGEPFRLRIFFNRDYSPSKDAISFIFSVADDSKPSPGHGT
LTALVPHDGIDYLGDPLEWGAGIESHEGQILTVLVKPPATCSVTEWRLDIDTKLLGDGSR
SYQLPLPVYILFNPWCADDQVYMADREQRKEYVMHDTTLIWRGSYNRLRPSVWKIGQFER
HVLECSLRLLGTVGRIPPAYRGDPVRVARALSALVNSVDDDGVLLGNWTEDFSGGTAPTK
WTGSAEILQQFHKTQKSVKFAQCWNFSGVLATIARALGIPARVITCYSSAHDTQASLTVD
VFIDANNKKLDAETTDSIWNYHVWNELWMQRPDLGIGQFGAYDGWQAVDATPQEASDNMY
RVGPASVLAVKHGEILRPFDCGFVYSEVNADKLYWRYNGPAQPLKLLRKDTLAIGHLIST
KAVLKWEREDITDSYKYAERSEEERNYMLRALKQSRHAFSRYYLNDNFNEVEFSMELKDD
IKVGENFTVVLKVSNKSKERTHQAAGQLNCDAVLYTGVGAKEVKIMGFELDLKPESSEYV
RMEVTFFEYFEKLSSQAAFQISAACHVKDTDYDYYAQDDFRVRKPDIKFQLGDGGAGGRI
VAQQETDVIVRLPNPLPIPLHKGLFTVEGPGIEQPLKFKIAEIPVGGTAAATFKYVPPYA
GRGTMIAKFAAKELDDVDGYKHYEIEPRPGDVLQPNGSHRSSNIIRRRTDVIP
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgagccattggtaccgcaactatgcgcccagttggatacagcgctggtggcatccatcg
ccgccagccaagccagtgaatccctttcgcagcacacgacccggtcccgatattgcaaat
gccgccagctcggcggtgctgggcgtgcagcgtgtggatccctgcctggcggacaaccat
gtggagcaccatacgagccacttttatgcggcggccgcgaaggaggcgctgatagtgcga
cgcggcgaaccgtttcggctgcgcatcttcttcaatcgggattacagtcccagcaaggat
gcgattagcttcattttcagcgtggccgacgacagcaaaccgagtccgggccatggcaca
cttacggctctggtgccgcacgatggcatcgactatctgggcgatccgctggaatggggc
gccggcattgagtcgcacgagggtcagatactcacggtgctagtgaagccgccggccaca
tgctccgtaaccgaatggcggctggatattgataccaagctgctgggcgatggctcgcgc
agctaccagctgcccctgcccgtctacatactctttaatccctggtgtgccgacgatcag
gtctatatggcggatcgggagcagcgcaaggagtatgtcatgcatgacacaaccctaatc
tggcgtggctcgtacaatcgcttgcgtccgtcggtctggaagatcggccagttcgagcgc
cacgtcctggagtgcagcctgcgtctcctgggcaccgtgggacgcattccgcccgcctat
cgtggcgatccggtgcgcgtggctcgtgctctgtccgcgctggtcaactccgtggatgat
gatggcgtgctgctgggcaactggacggaggatttctcgggcggcacagcgcctaccaag
tggacgggctccgcggagatattgcagcagttccacaagacgcaaaagtccgtcaagttt
gcgcagtgctggaattttagcggcgtcttggcgaccatagcccgggctctgggcattccg
gcccgtgtcatcacttgctactcttccgcgcacgatacgcaggcctcgctcacggtcgat
gtgttcattgatgccaacaacaagaaactggacgccgagacgacggactccatttggaat
tatcacgtgtggaacgagctgtggatgcagcgtccggatctgggcattggccagttcggt
gcctacgatggctggcaggcggtggacgccacgccccaagaggcctcggacaacatgtac
cgggtgggtcccgcctccgtgctggccgtcaagcacggcgagatcctgcgtcccttcgac
tgcggcttcgtctactccgaggtgaacgcggacaagctttattggcgctacaatggaccc
gcccagccgctgaagctgctgcgcaaggacaccctggccattggccatctgatcagcacc
aaggccgtgctgaagtgggagcgcgaggacatcaccgacagctacaagtacgcggagcgc
agcgaggaggagcgcaactatatgctacgggcgctaaagcaatcccgccacgccttcagt
cgctactatctgaacgacaacttcaacgaggtggagttcagcatggagctgaaggatgac
atcaaggtgggcgagaatttcaccgtggtgctcaaggtgagcaacaagagcaaggagcgc
acacaccaggctgccgggcagctaaattgcgatgccgtgctctatacgggcgtcggcgcc
aaggaggtgaagatcatgggcttcgaactggatctgaagccggagagcagcgaatatgtg
cgcatggaggtcacctttttcgagtacttcgagaagctctcgtcacaggctgctttccaa
atatccgccgcctgccatgtcaaggacacggactatgattactatgcccaggatgatttc
cgtgtgcgcaaaccggacatcaagttccagctgggcgatggcggcgccggcggtcgcatt
gtggcacagcaggaaacggatgtgattgtgcgtctgccgaatcccttgcccatacccctg
cacaagggtctgttcaccgtggagggacctggcatagagcagccgctcaagtttaagatt
gccgaaataccggttggcggcacggccgcagcgacgtttaaatatgtgccaccctatgcc
gggcgtggtacaatgattgccaagttcgccgccaaggagctggacgatgtggatggctac
aagcattacgagattgagccgcgacctggcgacgtgctgcagcccaacgggagtcacagg
agcagcaatataatacgccggcgcacggatgtcattccctga

DBGET integrated database retrieval system