KEGG   Drosophila virilis: Dvir_GJ17724Help
Entry
Dvir_GJ17724      CDS       T01066                                 

Definition
GJ17724 gene product from transcript GJ17724-RA
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
dvi  Drosophila virilis
Pathway
Glycerophospholipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dvir_GJ17724
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dvir_GJ17724
Enzymes [BR:dvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dvir_GJ17724
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 423 aa AA seqDB search
MQLKGTSILFALLLLTALFSVGNCFWPFSKRGRHPPKPAPPKEPQLSPVIFVPGDGGSQM
EARLNKSGTPYFICEKTHDWYNLWLDLEQLVIPMVYCWIDNVKLYYDKVTRTTHNTPGVE
TRVPGWGDPSVVEWIDPTKNKAGAYFKDIANVLVDLGYERHKNIHGAPYDFRRAPNENQQ
FFIDMKQLVEDTYEANNQTPVTFITHSMGSPMTLVFLQEQTLEWKSQYVRRQISLAGAWA
GSMKAVKVFAMGDDLDSFALSAKILREEQISHPSSAWLLPSPLFWKPSEVLASTPSRNYT
MAQLEQFFNDIDYRTGWEMRKDTMRYTQNFSPPDVELHCLYGDGVSTVERLQYKKDTIAG
ETPKLIMGLGDGTVNQRSLRACQHWTGYTDSHITTLALQGVDHLGILANQDVLQYVRTVM
QQP
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcaaggggaccagcatactgttcgcgctgctgctcctcacagctttgttcagt
gtgggaaactgtttttggccctttagcaaaagggggagacaccccccgaaacccgcgccg
cccaaggaaccgcagctatctccggttatatttgtgccaggcgatggtggctctcagatg
gaagcacgcttaaataaatcgggcacgccctacttcatatgcgagaagacgcacgactgg
tataatctctggctagatctggagcagttggtcataccgatggtctactgttggatagac
aatgtcaagctttactatgacaaggtgacacgcaccacacacaatacgccaggcgtggag
acgcgcgtacccggctggggtgatcccagcgtcgtggaatggatagatcccacgaaaaat
aaggccggcgcctactttaaggatattgccaatgtactggtagacctgggctatgagcgc
cacaagaatatacacggtgcaccctacgatttccgacgggcgccgaatgagaatcagcaa
ttctttattgatatgaaacaactcgtggaggacacatacgaggccaataatcagacgccc
gtcacttttataacgcacagcatgggcagccccatgacactagtctttctgcaggagcaa
acacttgagtggaagagtcaatatgtgcgccgtcaaattagtttggctggcgcttgggcg
ggcagcatgaaagctgtcaaggtgtttgccatgggcgatgatttggactcgttcgcgttg
agcgctaaaatactgcgcgaggaacagatctcgcatccgtcctccgcttggctgttgccc
tcgccgctattttggaagccctctgaggtgcttgcatcgacaccgtcgcgtaattacacc
atggcacagctggagcagttcttcaatgatattgactataggacgggctgggaaatgcgc
aaggatacaatgcgctatacacaaaactttagtcctccggatgtggagctacattgcctg
tatggcgatggggtcagcacagtggaaagattgcaatacaaaaaggacacgatagcagga
gaaacccccaagcttataatgggtctgggcgatggcaccgttaatcaacgttcactgcgc
gcctgccaacactggacgggctatacagactctcatataaccacactggcgctacagggt
gtcgatcacttgggcattttggccaaccaggatgtacttcaatatgtgcgcactgtcatg
cagcagccgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system