KEGG   Drosophila virilis: Dvir_GJ17852Help
Entry
Dvir_GJ17852      CDS       T01066                                 

Definition
GJ17852 gene product from transcript GJ17852-RA
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
dvi  Drosophila virilis
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Dvir_GJ17852
Enzymes [BR:dvi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     Dvir_GJ17852
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 913 aa AA seqDB search
MSSSLRIAIIGQSNFAADVLELLLERSIFQIVGVFTIPDKGSREDVLASTAASHNIPVFK
FASWRRKGMALPDVVAQYKSVGATLNVLPYCSQFIPIEVIDGASLGSICYHPSLLPRHRG
ASAISWTLIEGDEVAGFSIFWADDGLDTGPLLLQRQTNVEPTDTLDTIYKRFLYPEGVKA
MGEAVDMVAQGTAPKIIQTEVSATYDPAMFKAENQLLDLQQSAERIWNFVRGLDSVPGAI
ATVLEDDGSEQQVRLFGAHIYSAGPVKGGQPLKLKGLAKPAWVHEGGLLIEGTDGAFVNV
RRIKRGSKMINASDWFKQAEHQPITDFTDDELAKRTQLSGIWQAILKEPIEATTDFFAAG
AGSMDVVRLVEEVKEAFDVPLENEHVFMAPVFEEFFDQLIRSLRQGSGDASAKQLNYEGF
LLQANKREIRVPTQLFINGAFIDAEQQRTLDIINPTDEQVLCQVACASVNDVDKAVQAAH
KAFFGAWKQVSPRQRGQLMLKLADLMEQHKEELATIESVDSGAVYTLALKTHIGMSIDAW
RYFAGWCDKIQGNTIPVNPARPNNVLTFTRKEPIGVVGLITPWNYPLMMLSWKMAACIAA
GNTCLIKPAQTCPLTALKFAELTVLAGFPPGVINVLPGKGSDAGQAVADHQLVRKLGFTG
STPIGKHIMKSCAASNLKKCSLELGGKSPLIIFADCDLDKAVKHGMSSVFFNKGENCIAA
GRLFVEDRIHDEFVRRVLKDLRSMTIGDPLNRSTAHGPQNHKAHFDKLLEYCERGVAEGA
TLVYGGCRVPNLKGYFFMPTVFTNVEDDMFIAQEESFGPIMIISKFNGSDVDSVMERANR
TEYGLASGVFTKDISKALSFADRIEAGTVFVNVYNKTDVAAPFGGFKQSGFGKDLGQEAL
NEYLKTKCVTIEY
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgagttccagtctgcgcattgcgattattggccagagcaattttgcggccgatgtgctg
gagttgctgttggaacgttccatttttcaaatagtgggcgtgttcaccataccggacaag
ggcagtcgggaggatgttttggccagcaccgcggccagccacaatatacccgtcttcaag
tttgccagctggcgccgcaaaggcatggccctgcccgatgtcgtggcacagtacaaatcg
gtgggcgcaacgctaaatgtgctgccctattgctcacagttcatacccatagaggtgatt
gatggcgcctcgttgggcagcatttgctatcatccctccctattgcccaggcatcgcggc
gcgagcgccatatcctggacgctcatcgagggcgacgaggtggccggcttcagcattttc
tgggcggatgatggcttagacactggacccttgctgttgcaacgtcagaccaatgttgag
ccgacggacactttggacaccatctacaagaggttcttgtatccggagggtgtcaaggcc
atgggcgaggctgttgatatggtagcccagggcacagcgcccaaaataatccaaactgag
gtgagcgccacctatgatccggccatgttcaaagccgagaaccagctgctggatctgcaa
cagtccgcggagcgcatatggaattttgtgcgtggcctggactcggtgccgggtgctata
gctaccgtgcttgaagacgatggcagtgagcagcaggtgcgcttatttggcgcacatatc
tattccgctggacccgttaagggcggacagccgctgaagctgaagggcctggccaagccc
gcctgggtccacgagggcggcctgctaattgagggcaccgacggcgcctttgtgaatgtg
cgtcgcattaaacgtggctcgaagatgatcaatgccagcgattggttcaagcaggcggag
caccaacccatcacggatttcaccgacgatgagttggccaaacggactcagttgtctggc
atttggcaggccatactcaaggaacccatcgaggcaacgacggatttctttgccgccggc
gctggctccatggacgtggtgcgcctagtggaggaggtcaaggaggcattcgatgtgccg
ctagagaatgagcacgtctttatggcgcccgtctttgaggagttcttcgatcagctgatt
agaagcctgcgccagggcagcggcgacgccagcgccaagcagctcaactacgagggtttc
ctgctgcaggcgaacaagcgtgagattcgggtgcccacacagctcttcatcaatggcgcg
ttcatcgatgccgagcagcagcgcacactggacatcattaatcccaccgacgagcaggtg
ctctgccaggtggcctgtgcgagcgtgaacgatgtagataaagcggtgcaggcggcgcac
aaggcattctttggcgcctggaagcaggtgtcgccccggcaacgcggacagctcatgctg
aagctggccgatctgatggagcaacacaaggaggaactggccaccattgagtctgtggac
tcgggcgctgtctatacgctggccctgaagacccacattggcatgtccatcgatgcgtgg
cgctactttgccggctggtgcgataagatccagggtaatacgatacccgtgaatcccgcc
cggcccaacaatgtgctgacgtttacgcgcaaggaaccgattggtgtggttggcctgatc
acgccctggaattatccattgatgatgctctcctggaagatggctgcctgcatagccgcc
ggcaatacctgcctgatcaagccggcacagacatgccccctgacggcgctcaagtttgcc
gagctcaccgtgctggccggattcccgccgggcgtcatcaatgtgctgccgggcaagggc
tctgatgcgggtcaggctgtggccgatcatcagctggtgcgcaaactgggctttaccggc
tccacgcccattggcaagcacatcatgaaatcctgcgctgcatccaatctgaaaaaatgt
tcactggagctgggcggcaagagcccgctgatcattttcgctgactgtgatctggacaag
gctgtgaaacacggcatgtcctcggtcttctttaataagggtgaaaattgcatagccgcc
ggacgtctctttgtggaggatcgcattcacgacgagtttgtgcgtcgcgtgctcaaggat
ctgcgctcgatgaccattggtgatccactcaatcggtccacggcacacggtccacagaat
cataaggcgcacttcgataagctattggagtactgtgaacggggcgtggcagagggcgca
acgcttgtctatggcggttgtcgcgtgcccaatctgaagggttatttctttatgcccacc
gtattcaccaatgtcgaggatgacatgttcatagcacaggaagaatcattcggtccgatt
atgatcatctccaagttcaacggcagcgatgtcgactcggtcatggagcgtgccaatcgc
accgagtacggactggccagcggtgtctttaccaaggacattagcaaggccttgagcttt
gccgatcgcatcgaggcgggcaccgtcttcgtaaatgtctacaacaaaacggatgtggca
gctccatttggtggcttcaagcagagcggattcggcaaggatttgggccaggaggcgctc
aacgagtatctgaagaccaagtgtgtgaccattgagtactga

DBGET integrated database retrieval system