KEGG   Drosophila virilis: Dvir_GJ17885Help
Entry
Dvir_GJ17885      CDS       T01066                                 

Definition
(RefSeq) uncharacterized protein
  KO
K16174  small subunit ribosomal protein S18b, mitochondrial
Organism
dvi  Drosophila virilis
Brite
Ribosome [BR:dvi03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    Dvir_GJ17885
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S18 RecR TF_Zn_Ribbon
Motif
Other DBs
NCBI-GeneID: 6634007
NCBI-ProteinID: XP_002057828
FlyBase: FBgn0205053
UniProt: B4M9M5
Position
Unknown
AA seq 201 aa AA seqDB search
MLPLARGVYGSLAQITRNSRLALHTASVVRGKAEAAAENEAPAENSEETAANAAPDAKDR
TNKIPVETSIRYLKSAAYKTTYGDEFVWTQYRRNHKGMYAPRKTRKTCIRQGKISTGNPC
PICRDEYLVLDYRNTELLQQFISPFSGQVLSYSKTGLCQKSHLRLTVAVEQARDCGLITY
DVPFREYDYSEYYGKQEEQKK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgttacctttagcacgcggcgtttacggcagcttagcacaaataacccgcaacagtcgt
ctagcactacacacggccagcgtggtgcgtggcaaagcagaagcagctgcagaaaatgag
gcgccggcagaaaacagtgaagaaactgcagcaaatgcagcgccagatgccaaggatcgc
acaaacaaaatacccgtagagacttccatacgttacttgaaaagcgccgcctacaaaaca
acctacggtgatgaatttgtatggacacaatatcgtcgcaaccacaagggcatgtatgcg
ccgcgcaagacgcgtaaaacctgcatacgccagggcaaaattagcaccggcaatccgtgt
cccatatgccgtgatgagtatctggtgctggactaccgcaacacggagctcttgcagcag
ttcatttcgccgttcagcggccaagtgttgagctactccaaaacgggcctgtgccagaag
agtcatctgcgtctaacggtcgccgtggagcaggcacgcgactgtggtctgatcacctac
gatgtgcccttccgggagtacgactacagcgagtactatggaaagcaggaagagcagaag
aaataa

DBGET integrated database retrieval system