KEGG   Drosophila virilis: Dvir_GJ17885Help
Entry
Dvir_GJ17885      CDS       T01066                                 

Definition
GJ17885 gene product from transcript GJ17885-RA
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
dvi  Drosophila virilis
Brite
Ribosome [BR:dvi03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    Dvir_GJ17885
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 201 aa AA seqDB search
MLPLARGVYGSLAQITRNSRLALHTASVVRGKAEAAAENEAPAENSEETAANAAPDAKDR
TNKIPVETSIRYLKSAAYKTTYGDEFVWTQYRRNHKGMYAPRKTRKTCIRQGKISTGNPC
PICRDEYLVLDYRNTELLQQFISPFSGQVLSYSKTGLCQKSHLRLTVAVEQARDCGLITY
DVPFREYDYSEYYGKQEEQKK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgttacctttagcacgcggcgtttacggcagcttagcacaaataacccgcaacagtcgt
ctagcactacacacggccagcgtggtgcgtggcaaagcagaagcagctgcagaaaatgag
gcgccggcagaaaacagtgaagaaactgcagcaaatgcagcgccagatgccaaggatcgc
acaaacaaaatacccgtagagacttccatacgttacttgaaaagcgccgcctacaaaaca
acctacggtgatgaatttgtatggacacaatatcgtcgcaaccacaagggcatgtatgcg
ccgcgcaagacgcgtaaaacctgcatacgccagggcaaaattagcaccggcaatccgtgt
cccatatgccgtgatgagtatctggtgctggactaccgcaacacggagctcttgcagcag
ttcatttcgccgttcagcggccaagtgttgagctactccaaaacgggcctgtgccagaag
agtcatctgcgtctaacggtcgccgtggagcaggcacgcgactgtggtctgatcacctac
gatgtgcccttccgggagtacgactacagcgagtactatggaaagcaggaagagcagaag
aaataa

DBGET integrated database retrieval system