KEGG   Drosophila virilis: Dvir_GJ17913Help
Entry
Dvir_GJ17913      CDS       T01066                                 

Definition
(RefSeq) GJ17913 gene product from transcript GJ17913-RB
  KO
K04345  
protein kinase A [EC:2.7.11.11]
Organism
dvi  Drosophila virilis
Pathway
Longevity regulating pathway - multiple species
Wnt signaling pathway
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dvir_GJ17913
   04341 Hedgehog signaling pathway - Fly
    Dvir_GJ17913
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Dvir_GJ17913
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dvir_GJ17913
Protein kinases [BR:dvi01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   Dvir_GJ17913
Messenger RNA biogenesis [BR:dvi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Dvir_GJ17913
Chromosome [BR:dvi03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    Dvir_GJ17913
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 353 aa AA seqDB search
MGNNATTSNKKVDAAETVKEFLEQAKEEFEDKWRRNPTNTAALDDFERIKTLGTGSFGRV
MIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLRYHFKDNSNLY
MVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQ
GYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPP
FFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWF
ASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALRISSTEKCAKEFAEF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacaacgcgaccacatccaacaagaaggtggatgccgccgaaacggtcaaggag
ttccttgaacaggccaaggaggagttcgaggataaatggcgtcgcaatccaaccaatacc
gctgcccttgatgattttgagcgtatcaaaacgctgggcaccggctcctttggccgcgtc
atgatcgtccagcacaagcccacaaaagactattatgccatgaagatactggacaagcag
aaggtggtcaagctgaagcaggtggagcatacgctgaacgagaaacgcatcctgcaggcg
atacagtttccatttttggtctcgctgcgctaccatttcaaggacaactccaatctttat
atggtgctggagtatgtgcccggcggcgagatgttctctcatctgcgcaaagtcggacgc
ttctcggagccgcattcgcgcttctatgcggcacaaattgtgctcgcctttgagtatctg
cattatctggacctcatctatcgcgatctaaagccggagaatctattgatcgattcgcag
ggctatctgaaggttaccgattttggttttgccaagcgggtcaagggtcgcacctggacg
ctatgcggcacacccgagtatttggcacccgaaatcatcttgtccaagggctataataag
gccgtcgattggtgggcgcttggcgttttggtctacgaaatggccgccggttatccgccc
ttctttgcggatcagccgatacagatttatgagaagatcgtgtccggcaaggtgcgtttc
ccctcgcactttggctccgatctgaaggatctgttgcgcaatctgctgcaggtggatctg
accaagcgctatggcaatctgaaagcgggcgtcaatgatattaagaaccaaaaatggttc
gcctccacggactggattgcgatcttccaaaagaaaatcgaggcgccgttcataccgcgg
tgtaaaggtcccggcgatacaagcaattttgatgactacgaggaggaggcactgcggatt
tccagcaccgaaaagtgcgccaaggagtttgctgaattctag

DBGET integrated database retrieval system