KEGG   Drosophila virilis: Dvir_GJ17913Help
Entry
Dvir_GJ17913      CDS       T01066                                 

Definition
GJ17913 gene product from transcript GJ17913-RA
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
dvi  Drosophila virilis
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:dvi04310]
Environmental Information Processing; Signal transduction; Hedgehog signaling pathway [PATH:dvi04340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 476 aa AA seqDB search
MLKKSHHSSGTASGSGSGSEGKLQQQHSNEEEGGGAGGGQQEAAAASHKITPPTTTTTGA
TGATGAAEADATGTGTATTKRKSEAAAASGEEQPSNSSSSSPQAQVSASATFRLSSLTGT
ISKMGNNATTSNKKVDAAETVKEFLEQAKEEFEDKWRRNPTNTAALDDFERIKTLGTGSF
GRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLRYHFKDNS
NLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLI
DSQGYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAG
YPPFFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQ
KWFASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALRISSTEKCAKEFAEF
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaaaatcccatcatagttcaggaacggcaagcggcagcggcagcggatcagag
ggcaagttacagcagcagcacagcaacgaggaggaaggcggtggtgcagggggaggacag
caggaagcagccgccgctagccacaaaataacgccgccgaccacaacaacaacaggagca
acaggagcaacaggagcagccgaagcggacgcaacaggaactggaacagcgacaacaaaa
agaaaatcggaagcagctgctgcctctggcgaggagcagcccagcaacagcagcagcagc
tcaccccaggctcaagtgtcagccagcgccacgtttcgtttatcctcgctaacgggcacc
atctcgaaaatgggcaacaacgcgaccacatccaacaagaaggtggatgccgccgaaacg
gtcaaggagttccttgaacaggccaaggaggagttcgaggataaatggcgtcgcaatcca
accaataccgctgcccttgatgattttgagcgtatcaaaacgctgggcaccggctccttt
ggccgcgtcatgatcgtccagcacaagcccacaaaagactattatgccatgaagatactg
gacaagcagaaggtggtcaagctgaagcaggtggagcatacgctgaacgagaaacgcatc
ctgcaggcgatacagtttccatttttggtctcgctgcgctaccatttcaaggacaactcc
aatctttatatggtgctggagtatgtgcccggcggcgagatgttctctcatctgcgcaaa
gtcggacgcttctcggagccgcattcgcgcttctatgcggcacaaattgtgctcgccttt
gagtatctgcattatctggacctcatctatcgcgatctaaagccggagaatctattgatc
gattcgcagggctatctgaaggttaccgattttggttttgccaagcgggtcaagggtcgc
acctggacgctatgcggcacacccgagtatttggcacccgaaatcatcttgtccaagggc
tataataaggccgtcgattggtgggcgcttggcgttttggtctacgaaatggccgccggt
tatccgcccttctttgcggatcagccgatacagatttatgagaagatcgtgtccggcaag
gtgcgtttcccctcgcactttggctccgatctgaaggatctgttgcgcaatctgctgcag
gtggatctgaccaagcgctatggcaatctgaaagcgggcgtcaatgatattaagaaccaa
aaatggttcgcctccacggactggattgcgatcttccaaaagaaaatcgaggcgccgttc
ataccgcggtgtaaaggtcccggcgatacaagcaattttgatgactacgaggaggaggca
ctgcggatttccagcaccgaaaagtgcgccaaggagtttgctgaattctag

DBGET integrated database retrieval system