KEGG   Drosophila virilis: Dvir_GJ17940Help
Entry
Dvir_GJ17940      CDS       T01066                                 

Definition
(RefSeq) GJ17940 gene product from transcript GJ17940-RB
  KO
K07376  
cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
dvi  Drosophila virilis
Module
cGMP signaling
Brite
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     Dvir_GJ17940
Protein kinases [BR:dvi01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   Dvir_GJ17940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 1036 aa AA seqDB search
MACFPRLFHHRSKNKFTPAQDENTDTILNTQDSPVQIGLYIRREEKPLYSPIITPSASEA
QLQRLKQQPSSSSVQPLQAVAENVVSPSITGNTADNNADDSIGSQHQEQQQQQHPKKFRS
HKSRLQAEDREKEKEKFSTVNGSAINVTRTNSKLKPVKERRPTALPTEAPNVNGAQRVAD
VDADKELATGELEQVADVVDGESKLKGNANGIIDENGDNEAVKTPSTGTPSIFTPIPTPP
AKANVKFFIGHTQELNAEQPSDDILSWHSNDANNNNNSNSNKLTNGTLPGHAHGQRLAES
MTTTTATSPKVPAKSCSNVSLNYLRRSKSTIASTEPVTTSQRRRVSTMPDINIPTPPPMP
LELLKPVTPLHLRKKRSAERQASQDSLPVAAPDASASQDETSKLEDSERASRSSNGSATK
IHRVEGGLIYVRPNLPVQQNIEIEFNAKDEATRNLILNAIERNDFLNNLMDKERKDMVIN
AMAPASYKKNSYIINEHDEGSEIFVSAEGYYDVIQAGQNVGNFGPATVFGELAILYNAPR
KATIKAATDARVWKITRETFRAIMQISGSREREENLQFLRSAPFLQELEKSLLTKVVDLL
QRKFYETGSCIVREGEVGNEFFIIRGGTVTIKKKNQAGQEQIVAKRKRGDYFGEQALMNA
DVRQASVYADAPGTEVLKLEREAFISYLGTIRQLSEKPQAQTNNENGRSNSKGAEFDNEH
AHIAISDLKKVATLGAGAFGRVDLVTHNSKAFALKIIKKIEVIKQDQIEHVYNEKNVMIK
CRDSPFIVQLYRTYRNEKYVYFLMEACMGGDVWTVMSKRQYFDDKTAKFIAGCVVEAFDF
LHAHNFIYRDLKPENLMLSSDGYCKLVDFGFAKYVRPNEKTNTFAGTPEYVAPEIILDRG
HDRAVDYWALGILVYELLVGKTPFRGVNQIKIYQNILSGIDVIHMPSRIPKSAQHLIRHL
CKQLPAERLGYQRKGIADIKRHSWFESLDWTRLRQKQLPSPIKRNLRSLTDLQYFIHAQE
PDYEPPEELSGWDKDF
NT seq 3111 nt NT seq  +upstreamnt  +downstreamnt
atggcctgctttccgcgtctcttccatcatcgcagtaaaaacaaatttacgcccgctcaa
gatgagaacaccgacacgatactcaacacacaagatagccccgtgcaaattggtctctac
atacgacgcgaggagaaaccactttactcgcccataattacgcctagtgccagtgaggcg
caactgcagcgcctaaaacaacagccctccagttcctccgtccagccgctccaggctgta
gccgaaaatgtggtcagccctagcattactggcaacactgctgacaacaatgccgacgac
agcataggaagccagcaccaggagcagcagcaacagcagcatccaaagaagtttcgctcg
cacaaaagcaggcttcaggcagaggatagagaaaaggagaaggagaagttctcgacagtc
aatggaagtgcaattaatgtcacacgtaccaattcaaaattaaaacccgtcaaagaacga
cgccccaccgcactgcctaccgaggcgcccaacgtgaatggcgcccaacgtgtggctgat
gtggatgccgataaggaactggcaacgggggagctggagcaggttgctgatgttgtggac
ggagagtcaaagctcaaagggaatgcgaatggcataattgatgagaatggtgacaatgag
gctgtcaaaactccatcgacaggaacgccctcgatattcacaccaataccaacaccgcca
gcaaaggcaaatgttaaatttttcattggtcatacacaggaactaaatgccgagcagccc
tcagatgacattttgtcctggcatagtaatgatgctaacaacaacaacaacagcaacagc
aacaagctgacaaatggaacattaccaggacatgcacatggacagcggctggccgagtca
atgacgacgacaacggcgacgtcgccaaaggtgcccgcaaagagctgcagcaatgtgtca
ctcaattatcttagaaggtccaaaagcacgatagccagcactgagccagtgaccaccagc
cagcggaggcgtgtgtcgaccatgcccgacattaacataccaacaccaccacccatgcct
ctagagctcctaaagccggtaacaccgctgcatttgcgcaagaagcgaagtgcagagcgt
caagcttctcaggactcacttccagtagccgcccccgatgcttcagccagccaagatgaa
acgtccaagctagaggacagcgagagagccagcagaagcagcaatgggtctgcaacgaaa
atacatcgcgtggagggaggtctcatctatgtgcgaccgaatttgcccgtgcagcagaat
attgaaatcgaatttaatgcaaaggacgaagctacacgcaatctcatactcaatgccatc
gaacgaaacgatttcctcaataatctaatggacaaggagcgcaaggacatggtcatcaat
gcaatggcaccggccagctacaagaagaacagttacatcatcaatgagcacgacgagggc
tccgagatctttgtctccgccgaaggttactacgatgtcatacaagcgggtcagaatgtg
ggcaacttcgggccagccaccgtctttggtgaactagcaatactctacaatgcgccacgc
aaagccactataaaggctgccaccgatgcgcgagtttggaagattacgcgtgaaacgttt
cgtgccattatgcaaatctcgggctctagggagcgcgaggagaacttgcagttcctacgc
tcggctccatttctgcaggagctggagaagagtctactcaccaaagttgtcgatctgtta
cagcggaaattttacgagacaggcagctgcattgtacgcgagggcgaggtgggcaacgag
ttcttcatcatacgcggcggcacggtgaccatcaagaagaagaaccaagctgggcaggaa
caaattgtggccaagcgtaagcgtggcgactactttggggagcaggcactcatgaatgcg
gacgtccggcaggcgagcgtctatgcggatgcgccaggcactgaggtgctcaaactggag
cgagaggccttcatcagctacctgggcaccataaggcagctgagcgagaagccgcaagcg
cagaccaacaacgagaatgggcgttcaaatagcaaaggcgccgaattcgataatgagcat
gcacacatcgcaatctcggatctgaagaaagtagctactctgggtgctggcgcttttggt
cgtgtggatctggtcacgcacaacagtaaggcatttgcgctgaagatcattaagaagatc
gaggtgattaagcaggatcaaatcgagcacgtctacaatgagaagaatgtgatgatcaag
tgccgcgattcaccctttatagtgcaactctatcgcacctatcgtaatgagaagtatgtg
tactttctgatggaggcctgcatgggcggcgatgtctggacggtcatgtcaaagcgtcag
tatttcgatgataagactgccaagtttatagcgggctgcgtcgtagaagcctttgacttt
ctgcacgcgcataactttatctacagggacctcaagccggagaacctgatgctcagcagc
gatggctactgcaagctggtcgactttggcttcgccaagtacgtgcgtcccaacgagaag
accaacacgtttgccggcacgcctgagtatgtggcgcccgagattattttggatcgcggt
catgatcgcgccgtggactactgggcactgggcatacttgtgtatgagctgctggttggc
aaaacgccctttcgcggggtcaatcaaatcaagatctatcaaaacatcctgagtggcatc
gatgtcatacacatgccctcccgcatacccaagtctgcgcagcatctaatacggcatctg
tgcaagcagctgcccgccgagcggctgggctatcagcgcaagggcattgcggacattaag
cggcatagctggttcgagagcctggactggacgcgacttagacaaaaacagcttccctcg
cccattaagcgcaacctgaggagtttgacagacctgcaatactttattcacgctcaggag
ccagactacgagccgcccgaagagctaagtggctgggataaggacttctaa

DBGET integrated database retrieval system