KEGG   Drosophila virilis: Dvir_GJ18062Help
Entry
Dvir_GJ18062      CDS       T01066                                 

Definition
(RefSeq) GJ18062 gene product from transcript GJ18062-RB
  KO
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dvir_GJ18062
Protein kinases [BR:dvi01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   Dvir_GJ18062
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 727 aa AA seqDB search
MLDRCEMPIQLDNEKLRRDVRLSGSRLDLPQLCNVGRRLDGHMNNNGNSNSNNNSNNNNN
NNETTTSGNERGSSTKSNSSSGSSGNSASSTGSAELKCNTPMTPSELVKKYRNYLTDLEF
EELKVYKEVWYFGQHASKNYNKPAPAANTTNLGYDDDNGNYKIIEHDHIAFRYEILEVIG
KGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAVVELNILDELREKDADGSHNVIHMLD
YTYFRRHLCITFELMSLNLYELIKKNNYNGFSMSLIRRFCNSIVKCLRLLYKENIIHCDL
KPENILLKQRGSSSIKVIDFGSSCYVDRKIYTYIQSRFYRSPEVILGLQYGTAIDMWSLG
CILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVLISVARRRRLFFDSRDAPRCITNTK
GRKRSPGSKSLSQILHCQDRYFIDFLQRCLEWDPAERMTPDEAAHHEFLQPSASSRHRSC
RMSTSSSSSGLNSVSQKSSCYNFAEISPGNGPVVASITSTTAVSNAAITTKSSSSRQPHA
HAHAHAQSNGHLPDIKLSASDKYNSMQKVAVRSKITSSVSDLESVQQYSLHRIYGGVGSG
STHHVSSAATRKHLNGNTGGNVTNNSIGSSSKYGSTTLAHNHHNVTHHNASTATIATATH
HHHHHNHIVGVGGQTGGAAATNVAMAHSQSTGDVSDRAIFGRAXLRARPTKLELKKCKLV
NMMDFWS
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgttggatcgatgtgaaatgccgatacaattggacaacgagaagctgcgacgcgatgtg
cgtctgtccggctcgcgcctggacttgccacagctgtgcaatgtgggacgtcgccttgac
ggacacatgaacaacaatggcaacagcaacagtaataacaacagcaacaacaacaacaac
aacaacgagacaacaacaagcggcaacgagcgcggctcctcgaccaaatcgaacagcagc
agcggcagctccggcaactcggccagcagcacaggcagcgccgagctcaaatgcaacacg
cccatgacaccatcagagctcgttaagaaatatcgcaattatttgactgatctggaattt
gaggagctgaaggtgtacaaagaggtctggtatttcggccagcatgccagcaagaattac
aacaagcccgcccccgcagccaataccacaaacttgggctatgatgatgacaatggcaat
tacaagatcattgaacacgaccatatagcctttcgctacgagatattggaggtgatcggc
aaaggcagctttggccaggtgatcagagcgctcgatcacaagaccaacacgcatgtggcc
atcaagatcataaggaataagaagcgcttcctcaaccaggcggtcgttgagctcaatata
ttggacgagctgcgcgaaaaggatgcagatggatctcataatgttatacatatgcttgac
tatacatatttccgtagacatttgtgcatcaccttcgagctaatgagtctcaatctgtat
gagctgatcaagaagaataattataatggtttcagcatgagtctcatacgacgcttctgc
aattcgattgtgaaatgcctgcgtttgctctacaaggagaatatcatacactgtgatctc
aagccggaaaacattttgctgaaacaacgcggcagcagctcaataaaagtcatcgatttt
ggcagctcgtgttatgtggatcgcaaaatctatacctatatacaatcgagattctatcgc
tccccggaggtgatactgggtctgcaatatggcaccgccattgacatgtggagcttgggc
tgcatattggccgagctgtacacgggctttccgctattccccggcgagaacgaggtagag
caactggcctgcattatggaggtgctgggtctgccccctaaggtgctcatttcggtggcg
cgtcgccgtcgtctgttctttgattcgcgtgatgcgccgcgctgcataaccaatacgaag
ggccggaagcgttcgcctggcagcaaatccctgtcacagattcttcactgccaggatcgc
tatttcatagactttctgcagcgctgcctggaatgggatcctgcggagcgcatgacgccc
gatgaggcggcccatcatgagttcctgcagccatccgcatcgagtcgccatcgcagctgc
cgcatgtccacaagctcatcgagctcgggtctgaacagcgtctcccagaagtcctcctgc
tacaattttgcagagatctcgcccggcaacgggccagttgttgcatctatcactagcacc
acagccgtcagcaatgcggctattacgaccaagtcaagcagttcacgccagcctcatgcc
catgcccacgctcacgcccaatcgaacggacacctgcccgacatcaagctcagcgccagc
gacaaatacaacagcatgcagaaggtcgcagtgcgttcgaagatcacgtctagcgtctcc
gatctggagtcggtgcagcagtattcgctgcatcgcatctatggcggcgttggcagcggc
agcacccatcatgtttcctcggcagccaccaggaagcatctaaatggcaacacaggcggc
aatgtcaccaacaacagcatcggcagcagcagcaaatacggcagcaccacgctggcgcac
aaccaccacaatgtgacgcatcacaacgcttccacggccaccattgccacggccacgcat
catcatcatcatcataaccatatcgttggcgttggcgggcagacgggaggcgctgccgcc
acaaatgtggccatggcacattcacagtcgaccggcgatgtctcggaccgggcaatcttt
gggcgtgcctgacttcgggcgcggcccaccaagctggagctcaagaagtgcaagctggtt
aatatgatggacttctggagctag

DBGET integrated database retrieval system