KEGG   Drosophila virilis: Dvir_GJ18062Help
Entry
Dvir_GJ18062      CDS       T01066                                 

Definition
GJ18062 gene product from transcript GJ18062-RA
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
dvi  Drosophila virilis
Brite
Enzymes [BR:dvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dvir_GJ18062
Protein kinases [BR:dvi01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   Dvir_GJ18062
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 730 aa AA seqDB search
MLDRCEMPIQLDNEKLRRDVRLSGSRLDLPQLCNVGRRLDGHMNNNGNSNSNNNSNNNNN
NNETTTTSITTQNGNGSNNNLGSPVSCSTTNSGSGNERGSSTKSNSSSGSSGNSASSTGS
AELKCNTPMTPSELVKKYRNYLTDLEFEELKVYKEVWYFGQHASKNYNKPAPAANTTNLG
YDDDNGNYKIIEHDHIAFRYEILEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQ
AVVELNILDELREKDADGSHNVIHMLDYTYFRRHLCITFELMSLNLYELIKKNNYNGFSM
SLIRRFCNSIVKCLRLLYKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCYVDRKIYTY
IQSRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPP
KVLISVARRRRLFFDSRDAPRCITNTKGRKRSPGSKSLSQILHCQDRYFIDFLQRCLEWD
PAERMTPDEAAHHEFLQPSASSRHRSCRMSTSSSSSGLNSVSQKSSCYNFAEISPGNGPV
VASITSTTAVSNAAITTKSSSSRQPHAHAHAHAQSNGHLPDIKLSASDKYNSMQKVAVRS
KITSSVSDLESVQQYSLHRIYGGVGSGSTHHVSSAATRKHLNGNTGGNVTNNSIGSSSKY
GSTTLAHNHHNVTHHNASTATIATATHHHHHHNHIVGVGGQTGGAAATNVAMAHSQSTGD
VSDRAIFGRA
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgttggatcgatgtgaaatgccgatacaattggacaacgagaagctgcgacgcgatgtg
cgtctgtccggctcgcgcctggacttgccacagctgtgcaatgtgggacgtcgccttgac
ggacacatgaacaacaatggcaacagcaacagtaataacaacagcaacaacaacaacaac
aacaacgagacaacaacaacgtcaataacaactcaaaatggtaatggcagcaacaacaat
ctgggctctccggtttcctgctcgaccacaaacagcggcagcggcaacgagcgcggctcc
tcgaccaaatcgaacagcagcagcggcagctccggcaactcggccagcagcacaggcagc
gccgagctcaaatgcaacacgcccatgacaccatcagagctcgttaagaaatatcgcaat
tatttgactgatctggaatttgaggagctgaaggtgtacaaagaggtctggtatttcggc
cagcatgccagcaagaattacaacaagcccgcccccgcagccaataccacaaacttgggc
tatgatgatgacaatggcaattacaagatcattgaacacgaccatatagcctttcgctac
gagatattggaggtgatcggcaaaggcagctttggccaggtgatcagagcgctcgatcac
aagaccaacacgcatgtggccatcaagatcataaggaataagaagcgcttcctcaaccag
gcggtcgttgagctcaatatattggacgagctgcgcgaaaaggatgcagatggatctcat
aatgttatacatatgcttgactatacatatttccgtagacatttgtgcatcaccttcgag
ctaatgagtctcaatctgtatgagctgatcaagaagaataattataatggtttcagcatg
agtctcatacgacgcttctgcaattcgattgtgaaatgcctgcgtttgctctacaaggag
aatatcatacactgtgatctcaagccggaaaacattttgctgaaacaacgcggcagcagc
tcaataaaagtcatcgattttggcagctcgtgttatgtggatcgcaaaatctatacctat
atacaatcgagattctatcgctccccggaggtgatactgggtctgcaatatggcaccgcc
attgacatgtggagcttgggctgcatattggccgagctgtacacgggctttccgctattc
cccggcgagaacgaggtagagcaactggcctgcattatggaggtgctgggtctgccccct
aaggtgctcatttcggtggcgcgtcgccgtcgtctgttctttgattcgcgtgatgcgccg
cgctgcataaccaatacgaagggccggaagcgttcgcctggcagcaaatccctgtcacag
attcttcactgccaggatcgctatttcatagactttctgcagcgctgcctggaatgggat
cctgcggagcgcatgacgcccgatgaggcggcccatcatgagttcctgcagccatccgca
tcgagtcgccatcgcagctgccgcatgtccacaagctcatcgagctcgggtctgaacagc
gtctcccagaagtcctcctgctacaattttgcagagatctcgcccggcaacgggccagtt
gttgcatctatcactagcaccacagccgtcagcaatgcggctattacgaccaagtcaagc
agttcacgccagcctcatgcccatgcccacgctcacgcccaatcgaacggacacctgccc
gacatcaagctcagcgccagcgacaaatacaacagcatgcagaaggtcgcagtgcgttcg
aagatcacgtctagcgtctccgatctggagtcggtgcagcagtattcgctgcatcgcatc
tatggcggcgttggcagcggcagcacccatcatgtttcctcggcagccaccaggaagcat
ctaaatggcaacacaggcggcaatgtcaccaacaacagcatcggcagcagcagcaaatac
ggcagcaccacgctggcgcacaaccaccacaatgtgacgcatcacaacgcttccacggcc
accattgccacggccacgcatcatcatcatcatcataaccatatcgttggcgttggcggg
cagacgggaggcgctgccgccacaaatgtggccatggcacattcacagtcgaccggcgat
gtctcggaccgggcaatctttgggcgtgcctga

DBGET integrated database retrieval system