KEGG   Drosophila virilis: Dvir_GJ18093Help
Entry
Dvir_GJ18093      CDS       T01066                                 

Definition
GJ18093 gene product from transcript GJ18093-RA
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
dvi  Drosophila virilis
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dvir_GJ18093
Enzymes [BR:dvi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Dvir_GJ18093
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 297 aa AA seqDB search
MATTAAAVAATSVVVLDRGNNTTCTINLHGATVVSWRVNNQEQLFVSKLASFDGKKAIRG
GIPFVFPQFGPWSFGPQHGFARITRWHLDRAPERLHNGDVEAIFSLMDNEFTRSIWNYQF
RITYRLILREKELHFHIGVYNPSKDLSFTFNMLLHTYLKVPDVRRCQITGLQGCHFIDKT
REGALYQEGREVVTVNEWTDRIYQHTPQEHVITNVVSGRKMRLHKYNFPDTVIWNPWIDR
SREMSDFGDDEFPNMLCVEAGNVSSPVILLPGTCFEASQILQIIIEGNVSRKTKRNR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggccacgacagcggctgccgtggcagccaccagtgtcgtcgtattggatcgtggcaat
aatacgacatgcacaatcaacttgcatggcgccacagttgtgtcttggcgtgttaataat
caggaacagttgtttgtcagtaagctggcgtcgtttgatggcaaaaaggcgatacgtggt
ggcataccctttgtatttcctcaatttggaccctggtccttcggaccacagcatggcttt
gcaagaatcacgcgctggcatttagatcgcgcacctgaacgcttacacaatggcgatgtg
gaggcaattttctcgctaatggacaacgagtttacccgatctatatggaactatcaattt
cgcatcacctaccggctgatactgcgcgagaaagagctacactttcacattggcgtctat
aatcctagcaaagatctgagctttacattcaacatgctgctccatacctatctaaaggtg
ccagatgttcgacgctgtcaaataactggactacagggctgtcattttatagataagaca
cgcgagggtgctttgtatcaagagggtcgcgaggtagtcacagtcaatgagtggacagat
cgcatctatcagcatacaccgcaggagcatgtgattaccaatgtggtatccggccgtaag
atgaggctacacaaatacaattttccagatacggttatttggaatccgtggattgatcga
tcacgtgagatgagcgactttggcgacgacgaattccccaatatgttgtgcgtagaagct
ggcaatgtcagctcaccagtcatactgctacctggcacctgtttcgaggccagccagata
ctacagatcatcatcgagggcaatgtaagtcgcaagaccaaacggaatcgctag

DBGET integrated database retrieval system