KEGG   Drosophila virilis: Dvir_GJ18109Help
Entry
Dvir_GJ18109      CDS       T01066                                 

Definition
GJ18109 gene product from transcript GJ18109-RA
Orthology
K05122  
receptor tyrosine kinase-like orphan receptor 1 [EC:2.7.10.1]
Organism
dvi  Drosophila virilis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 653 aa AA seqDB search
MPLNQISGICQLYNGTICNEFLRNSHVFISPNVTINDLEDRLKAAYGVIKESKDMNSNCR
KYALPSLCLSSLPICRTPERTNLLYFANVAMITNKYSGNETRKKRFLLKDPKNRHSFLKK
KPVYYNDVFTNDVSSKYPPTKESENLKRICREECELLENELCQKEYAIAKRHPVISVVGV
EECQKIPREKDCSSLGITIEVDDAEDCYWEDGSSYRGIENVSISGKPCLRWSWLMKEISD
FPELIGQNYCRNPGKVEKNPWCFVDDQSLDRSIEPCNIPKCVDKLWLTIISILALAAVAV
VLTSVLILKKKSSRGMKNIQSINTPNAGNNIYGNSQLNSNQDTGRMNLNSSIELVGIPSK
NMEKNSLLRIPHFTLQDVEFFEELGEGAFGKVYKGQLTQPNKKIVNVAIKALKENASIKT
QQDFRREIELISDLKHQNIVCILGVILNKEPYCMLFEYMANGDLHEFLISNSPIEKKTLL
QLEFLQIAIQISEGMEYLSGHHYVHRDLAARNCLVNEGLIVKISDFGLSRDIYSSDYYRV
QSKSLLPVRWMPSESILYGKFTTESDIWSFGVVLWEIYSYGMQPYCGYSNPEVIHLIRSR
QLLSCPENCPTAVYSLMMECWHEQAVKRPTFSDISHRLKTWYDGHVKISNQNI
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgccacttaaccaaatttctggaatatgtcaattgtataatggaacgatttgtaatgag
tttttaagaaactctcacgtttttatatcgcctaatgttaccatcaatgacttagaggat
cgattaaaggcggcttatggagttataaaagaatctaaagatatgaattcgaattgccga
aaatatgcactgccgagcttatgcttgagctctctaccaatttgtagaactccagaacga
accaatttattgtactttgccaatgtcgcaatgattacaaacaagtacagtggaaatgag
acacgaaaaaaaagatttcttttaaaagatcctaaaaatagacattcctttcttaaaaaa
aaacccgtttattacaacgatgtatttactaatgatgtatcaagcaaatatccaccgact
aaagaatctgaaaacttaaaacgaatttgtcgagaagaatgtgagcttctagaaaatgag
ctttgccaaaaagaatacgctatagcgaaacgacatcctgtaattagtgtagtaggagtt
gaagagtgtcaaaaaataccacgagaaaaagattgctcctcattaggcattacgattgaa
gtagacgatgctgaagattgctattgggaggatggttcaagttaccgaggaattgaaaac
gtgagtatatcgggaaaaccgtgcctcagatggtcgtggttgatgaaggaaatttcggac
tttccagaacttataggacaaaactattgcaggaacccaggaaaagttgaaaagaacccg
tggtgttttgtagatgaccaatctttagatagaagtattgaaccttgcaatattccaaaa
tgtgtcgataagctctggctaacaataatttcaatattggcgttggcagctgtagctgtt
gtcctaacttcagttcttattttaaaaaagaaaagttctcgtggaatgaaaaatatacaa
agtattaatacaccaaacgccggaaataatatatatggaaattcacaattaaactcaaac
caagatacaggaagaatgaatttaaatagttccattgaacttgtaggcatcccatctaaa
aatatggaaaaaaattcacttttgcgaataccacactttacattacaagatgtagagttc
tttgaagaattgggcgagggagcttttggaaaagtatataaagggcaactaacgcaaccc
aacaaaaaaattgtaaatgttgccattaaagcattaaaagaaaacgcctcaattaaaaca
caacaagatttcaggcgtgagattgaattaatatcagatcttaagcaccaaaacattgtt
tgcatacttggggtgattttaaataaagagccttactgtatgcttttcgaatatatggcg
aatggtgacttgcatgaatttctaatatcaaattcgcctattgaaaaaaaaacattatta
caactggaatttctacaaatagcaatacaaataagtgagggaatggaatacttatcaggt
catcactatgttcatcgtgatttagctgctcgaaactgtttggtcaatgaaggtttgatt
gtaaaaatttctgattttggattgtcacgggatatttacagttctgattattacagggtg
caatcaaaatcgttacttcctgttcggtggatgccatccgagtctattttatatggaaaa
tttacaactgaaagtgatatatggtcttttggagttgttctttgggaaatatatagttat
ggaatgcagccgtattgtggttacagcaatccagaggtaatacatttaattagatcccgc
caattactctcttgtccagaaaattgcccaacggcggtgtattctttaatgatggaatgt
tggcatgaacaagcagtaaaacgtccgacattttcagacatatcgcaccgattaaagact
tggtatgacggtcatgttaagatcagtaaccaaaatatttaa

DBGET integrated database retrieval system